Navigation Links


Tag: "eludes" at biology news

A large step forward in the fight against African sleeping sickness

...the antibodies that the body produces. Parasite eludes human defense mechanism Fortunately, our body has a special defense mechanism that can help us in the fight against African trypanosomes. Our blood contains ApoL-1, which is toxic to − and neutralizes − most types of trypanosomes. Howe...

Better sludge through metagenomics

...ulture of the organism, which, like most microbes, eludes laboratory culture. We expect that clues hidden in the genome will lead to domestication of this mysterious organism, enabling further studies of its habits and lifestyle. "The genome sequence will also enable biologists and engineers to understan...

Scientists unveil piece of HIV protein that may be key to AIDS vaccine development

...e been stymied by the seemingly unlimited ways HIV eludes natural and vaccine-induced immune defenses. Notes Dr. Kwong, "The more we learned about HIV, the more we realized just how many levels of defense the virus has against attacks by the immune system." For example, not only does HIV mutate rapidly and ...

1

Other Tagsavoidance 2avoidance 3torn 2suspected 2suspected 3suspected 4suspected 5suspected 6suspected 7suspected 8huge 2huge 3huge 4huge 5huge 6huge 7huge 8huge 9huge 10conventional 2conventional 3conventional 4conventional 5conventional 6conventional 7conventional 8conventional 9conventional 10suicide 2region 2region 3region 4region 5region 6region 7region 8region 9region 10
(Date:11/30/2009)...ratures continue to rise scientists are presented ...ecies respond and adapt. In a paper published in ...odriguez-Trelles and Dr Miguel Rodriguez assess th... of approximately 0.6˚C has already affected ...ng ecologists and evolutionary biologists is to pr...
(Date:11/30/2009)...report published in the December 2009 print issue ...lar type of control over their fertility that wome...sts have found how and where androgenic hormones w...on and male fertility. This opens a promising aven...discovery also offers hope to those who cannot hav...
(Date:11/26/2009)...r impressive antlers, red deer have been caught in... antlers are much more than decorative. They are l...ing. John Currey, from The University of York, UK,...f bone for over half a century and has become fasc...ugh a long-standing collaboration with Tomas Lande...
Breaking Biology News(10 mins):How can scientists measure evolutionary responses to climate change? 2Tough yet stiff deer antler is materials scientist's dream 2Deerfield Spa The Poconos Most Affordable Destination Spa Schedules Ribbon Cutting Event for Grand Opening of New Day Spa 51478 1Deerfield Spa The Poconos Most Affordable Destination Spa Schedules Ribbon Cutting Event for Grand Opening of New Day Spa 51478 2Hologic to Present at the 29th Annual Canaccord Adams Global Growth Conference 51475 1Hush little baby Linking genes brain and behavior in children 9237 1Hush little baby Linking genes brain and behavior in children 9237 2
(Date:11/30/2009)...30 At a briefing of the...and the Consortium for Citizens with Disabilities ...ic Policy and Advocacy for NCOA, called on Congres...sponds to the growing crisis in long-term care for...ns of seniors, after working hard all their lives,...
(Date:11/30/2009)...mic is far from over. Every year, almost three mi...lion die from AIDS-related diseases." ,, WASHI... AIDS Day 2009 the Global AIDS Alliance (GAA) call...n two recent alarming reports from the World Healt...c continues to be of catastrophic proportion, affe...
(Date:11/30/2009)...g significant impact, CBO analysis understates the...ewswire/ -- The Blue Cross and Blue Shield Assoc...rding the estimate released today by the Congressi...irmed what many economists, actuaries, and health ...lthcare reform bill would make coverage more expen...
(Date:11/30/2009)...s equivalent to 113 chest X-rays, study finds , ... than half of patients who have abdominal/pelvic C...ts that expose them to extra radiation, U.S. resea...d pelvic series were performed on 500 patients age...30 to 50 years of age. The researchers concluded t...
(Date:11/30/2009)... 30 SEIU Local 21LA mem...ration Sodexo will hold a rally Tuesday, Dec. 1, 2...headquarters, 3800 Desire Parkway, New Orleans, to...y disciplinary policies that target employees who ...er. Sodexo employees who clean schools in the Reco...
Breaking Medicine News(10 mins):Health News:NCOA, Bedlin Brief Leading Aging Organizations on Health Care Reform, Needed Long-Term Care Provisions 2Health News:GAA Calls on President Obama to Act on the Reality of AIDS 2Health News:GAA Calls on President Obama to Act on the Reality of AIDS 3Health News:CBO Confirms That Premiums Will Increase Under the Senate Healthcare Reform Bill 2Health News:CT Scan Patients May Get Unnecessary Imaging 2Health News:As H1NI Hits New Orleans in Force: School Custodians to Hold Rally to Call on Contractor to Stop Penalizing Workers Coping With Illness 2
Other Contentsridgeridgemicrocephalymidwifemidwifeheadachesheadachesheadachesheadachesheadaches