Navigation Links


Tag: "canal" at biology news

Reconstructing the biology of extinct species: A new approach

...h species, measuring the size of each semicircular canal and calculating the radius of curvature. Most of ... fast and agile. The scientists then compared the canal size of each species to its category of movement. The results revealed a highly significant stat...

Researchers use MRI to predict recovery after spinal cord injury

...s: maximum spinal cord compression (MSCC), maximum canal compromise (MCC) and length of lesion (LOL). They also looked at other factors, including bleeding within the spine, swelling and soft tissue injury. The results showed that severity of MSCC, bleeding and cord swelling were key indicators of a poo...

MIT engineers probe spiders' polymer art

... flows from the gland through an S-shaped, tapered canal to the outside of the spider's body, the long protein molecules become aligned and the viscosity (or resistance to flow) drops by a factor of 500 or more. As the resulting liquid exits the abdomen through the spinneret, it has the characteristics ...

Stimulation of the semicircular canals can artificially control human walking and balance

... found that artificial stimulation of semiciruclar canal nerves afforded "remote control" that was accurate enough to keep subjects on pathways and avoiding obstacles while walking blindfolded through botanical gardens. The researchers also found that with a subject's head in another position, exactly the ...

Frog’s ear canal may provide insights for understanding human hearing loss

...ibrations to the inner ear. The presence of an ear canal not only protects A. tormotus' thin and fragile eardrum from the environment, but also lessens the distance between the eardrum and the inner ear, thus allowing the bones of the middle ear to be shorter, and as a result, lighter in weight. Scientist...

Study uncovers placental microtransfusions lead to transmission of AIDS virus during childbirth

... by such suggested methods as sanitizing the birth canal may not work, he said. A better alternative might be to have pregnant women start taking anti-retrovirals before going into labor. ...

Researchers discover stem cell 'guide' that may be key for targeting neural stem cell treatments

...es in both brain hemispheres connected the central canal of the spinal cord. Zhou and his colleagues discovered how PK2 guides the migration of neurons born from neural stem cells from the subventricular zone in the brain's core through mature tissue to reach the olfactory bulb, the "smell" part of the br...

Transgenic plants remove more selenium from polluted soil than wild plants, new tests show

...ron remain in the San Luis Drain, a concrete-lined canal originally intended to channel irrigation wastewater from Central Valley farms to the Sacramento River Delta near Antioch. Selenium is considered an essential trace mineral for both humans and animals, but it becomes toxic at high doses. The dangers ...

1

Other Tagstied 2tied 3tied 4tied 5monitoring 2monitoring 3monitoring 4monitoring 5monitoring 6monitoring 7monitoring 8monitoring 9monitoring 10neglected 2neglected 3along 2along 3along 4along 5along 6along 7along 8along 9along 10floating 2
(Date:9/5/2008)..., Evolutionary studies of aging typically ut...mice) under benign conditions constant temperatur...in the laboratory. Oddly enough, very little is kn...ressful natural environments. Could it be that the... slowly in captive luxury than do their wild cousi...
(Date:9/5/2008)... Bats, ability to echolocate may have evolved mor...week by Queen Mary, University of London scientist...te do not all group together in the evolutionary t...cholocating cousins, the fruit bats. This has rais...s evolved more than once, or whether the fruit bat...
(Date:9/4/2008)... Heidelberg, 5 September 2008 Even scientists de...ttle surprise that the media also have various way... new study appearing in the October 2008 issue of ...based on the analysis of 300 articles in British a... The Daily Mail from the UK; and Aftenposten, Dagb...
(Date:9/4/2008)... A unique partnership between Syracuse University...tter access to life-saving vaccines for children l...e world. The Institute recently awarded $250,000 ...ssistant professor of chemistry in the College of ...ainst tetanus and rotavirus, a severe form of diar...
Breaking Biology News(10 mins):Old before their time? Aging in flies under natural vs. laboratory conditions 2Molecular evolution is echoed in bat ears 2What is a gene? 2Syracuse University partners with Serum Institute of India to develop vaccines for children 2Syracuse University partners with Serum Institute of India to develop vaccines for children 3Syracuse University partners with Serum Institute of India to develop vaccines for children 4CryoCath to present at Piper Jaffray and BMO Healthcare conferences 6960 1CryoCath to present at Piper Jaffray and BMO Healthcare conferences 6960 2Masimo Corporation Given Approval to Market the Masimo Rad 57 Pulse CO Oximeter in Japan 1960 1Masimo Corporation Given Approval to Market the Masimo Rad 57 Pulse CO Oximeter in Japan 1960 2Masimo Corporation Given Approval to Market the Masimo Rad 57 Pulse CO Oximeter in Japan 1960 3Masimo Corporation Given Approval to Market the Masimo Rad 57 Pulse CO Oximeter in Japan 1960 4Amsterdam Molecular Therapeutics Initiates Program for Late Stage Liver Cirrhosis and Reports Strong Progress in AMT 011 With Trial Fully Recruited an 6952 1Amsterdam Molecular Therapeutics Initiates Program for Late Stage Liver Cirrhosis and Reports Strong Progress in AMT 011 With Trial Fully Recruited an 6952 2Amsterdam Molecular Therapeutics Initiates Program for Late Stage Liver Cirrhosis and Reports Strong Progress in AMT 011 With Trial Fully Recruited an 6952 3Amsterdam Molecular Therapeutics Initiates Program for Late Stage Liver Cirrhosis and Reports Strong Progress in AMT 011 With Trial Fully Recruited an 6952 4Canceled 3A Homecare Rally in Contra Costa County 6949 1
(Date:9/5/2008)...G, Pa., Sept. 5 /PRNewswire-USNewswire/ -- Childre...r access to comprehensive,services to protect thei...n,in grants that were announced today by the Depar...vices for children and families, the department,be...ren,s Services Planning,initiative, ICSP, in 2004....
(Date:9/5/2008)..., Md., Sept. 5 /PRNewswire-USNewswire/ -- The Heal...day announced $39 million in grants to,increase an...centers., "These grants continue President Bush,s...whose services now reach more economically,vulnera...r before," HRSA,Administrator Elizabeth M. Duke sa...
(Date:9/5/2008)...ontrolled, but you need to know what triggers them...thDay News) -- If you are one of the 36 million Am...is nowhere in the United States that is free from ... shows. , Allergies don,t only happen in the sp...ell. In the fall, the most challenging cities to l...
(Date:9/5/2008)...N, Sept. 5 /PRNewswire-USNewswire/ -- Speaker Nanc...upport of the aims of the "Stand,Up to Cancer" tel...re is not a person in our country who has not seen...s 565,000 Americans annually, and each,year there ... must work,together to make eradicating the scourg...
Breaking Medicine News(10 mins):Health News:Pennsylvania Counties Receive Grants to Improve Services for Children 2Health News:HRSA Announces $39 Million in Grants to Expand, Improve Health Center Services 2Health News:No Place Safe From Allergies 2
Other Contentsjumpingjumpingjumpingjumpingwalkwalkwalkwalkwalkwalkwalkwalkchymecircularcircularcircularcircularcircularcircularcircularcircularcirculatorycirculatorycirculatorycirculatorycirculatorycirculatorycistroncladogenesis