Navigation Links


Tag: "arms" at biology news

Researchers shed light on shrinking of chromosomes

...nto two takes place. Like this, no long chromosome arms extend over the plane of division, because that could expose the DNA to serious mechanical damage.” The extreme condensation of chromosomes towards the end of cell division can also serve as a safety net if something goes wrong with chromosome sep...

Lessons from the orangutans: Upright walking may have begun in the trees

...t typically is. Moving on two legs and using their arms primarily for balance, or "hand-assisted bipedalis...n medium-sized branches, the orangutans used their arms more to support their weight, changing their moving style to incorporate hanging. They only tended t...

From the deep -- Researchers find new species of sea anemone

...OVs). Deep sea ROVs are also equipped with robotic arms and suction devices that are used to collect species. "It's like a submarine that's manned from the surface," said Daly, who plans to head to Monterey Canyon later this year in hopes of finding more dead whales with A. pearseae roosting on the bon...

Cancer researchers add spice to research against rare neuromuscular disease

...culty speaking and swallowing, and weakness in the arms and legs. Patients are often diagnosed in their 30s and 40s, and while most live a normal life span, many patients end up using a wheelchair and have serious health difficulties. Currently there is no way to slow the progression or prevent the diseas...

Moonlighting enzyme linked to neurodegenerative disease

...Symptoms are mild at first: muscle weakness in the arms and legs, vision impairment and slurred speech, but eventually the symptoms progress and most patients become wheelchair-bound and succumb to heart failure later in life. There is no cure at this time, but Mayo Clinic researchers have identified muta...

MIT device draws cells close -- but not too close -- together

...f tools such as the microscopes or robotic control arms typically required by MEMS devices. Because cells communicate via signals transmitted both through the touching of cell membranes and through soluble molecules that flow between separated cells, biologists need to vary the spacing of cells to stud...

Researchers show that veins stiffen as we age

...uges, connected to computers, were placed on their arms and legs. An arterial cuff was attached to an upper arm to monitor blood pressure, and venous cuffs were placed around the upper thigh and upper arm to measure the blood flow to the limbs. As the cuffs were inflated over an eight-minute period, and...

Ancient birds flew on all-fours

...rom trees using primitive feathered wings on their arms and legs, according to new research by a University of Calgary paleontologist. In a paper published in the journal Paleobiology, Department of Biological Sciences PhD student Nick Longrich challenges the idea that birds began flying by taking off fro...

Study shows how herpes infects cornea, evades immune cells

...pictures, it looks like the stroma cells form long arms that reach out and collect the virus particles, and then wrap around them, forming a sac, and bring them into the cell body," Shukla said. In phagocytes, ingested foreign particles are destroyed in the sacs, which are highly acidic. But even though...

How does a zebrafish grow a new tail?

...nts for people whose hearts, spinal cords, eyes or arms and legs have been badly hurt. Scientists have ... the first place that renders us unable to re-grow arms and legs," said Cristi Stoick-Cooper, a graduate student in the multidisciplinary Neurobiology and B...

Electronic chip, interacting with the brain, modifies pathways for controlling movement

... contraction of certain muscles, like those in the arms and legs. The possibility that these neural signals can be recorded directly and used to operate a computer or to control mechanical devices outside of the body has been driving the rapidly expanding field of brain-computer interfaces, often abbre...

New finding points way to foiling anthrax's tricks

...ocalin to defend against bacteria in the continual arms race between pathogen and host. This is the first example of a protein produced by the human immune system that disrupts bacteria's iron scavenging system," said Ken Raymond, UC Berkeley professor of chemistry and faculty scientist at Lawrence Berkel...

'Smart' genetic therapy helps the body to heal itself

...s develop muscle weakness and atrophy of the legs, arms and trunk. In patients with SMA the survival motor neuron genes (SMN1) is deleted, but they all carry a copy gene (SMN2). However, this only produces about 10% of the correct protein; insufficient to prevent the diseases. The severity of the SMA...

What controls stickiness of 'smart' chromosomal glue

...ential for cohesins to get removed from chromosome arms before they are removed from centromeres, Amon sai...utely essential to remove cohesins from chromosome arms during the initial meiotic stages, and if you don't have recombination that does not happen properly...

Mussels evolve quickly to defend against invasive crabs

... of zoology. "It's an important development in the arms race between these crabs and these mollusks." Crabs prey on blue mussels by crushing their shells. Freeman looked at the inducible defense ?shell thickening ?of blue mussels (Mytlius edulis) in the presence of two invasive crab species in New Engl...

Novel therapy combinations gain ground in treating hepatitis

...itabine alone (800 mg/d), one of three combination arms with the drug at 400 mg/d, 800 mg/d or dose-rampin... results show that the two higher-dose combination arms had much better response rates than the control group, experiencing on average a 2.5 to 3.0 log decr...

Spinal cord bridge bypasses injury to restore mobility

...d result in loss of the ability to breathe or move arms or legs, depending upon the injury site. Silver said the medical community also assumed that the cut axon tips died when they hit the scar wall. In prior research in his lab by his graduate student, Tom, it was discovered that axons are alive and ...

Research reveals inner workings of immune system 'thermostat'

...ntists believe that the pro- and anti-inflammatory arms of the immune system just antagonize each other," ...in 10. "What we see is that the 'hot' and 'cool' arms of the immune system aren't independently regulated," Yap said. "They talk to each other and respond...

Seeing the serpent

...tter at detecting them. "There's an evolutionary arms race between the predators and prey. Primates get better at spotting and avoiding snakes, so the snakes get better at concealment, or more venomous, and the primates respond," Isbell said. Some primate groups less threatened by snakes show fewer si...

Radiation-killed bacteria vaccine induces broad immune response in mice

...uld stimulate a strong response not only from both arms of the adaptive immune system (antibodies and T ce...a vaccine that elicits a strong response from both arms of the adaptive immune system, Dr. Raz and his colleagues have opened the possibility of making a va...

1 2 3

Other Tagstied 2tied 3tied 4tied 5monitoring 2monitoring 3monitoring 4monitoring 5monitoring 6monitoring 7monitoring 8monitoring 9monitoring 10neglected 2neglected 3along 2along 3along 4along 5along 6along 7along 8along 9along 10floating 2
(Date:9/5/2008)..., Evolutionary studies of aging typically ut...mice) under benign conditions constant temperatur...in the laboratory. Oddly enough, very little is kn...ressful natural environments. Could it be that the... slowly in captive luxury than do their wild cousi...
(Date:9/5/2008)... Bats, ability to echolocate may have evolved mor...week by Queen Mary, University of London scientist...te do not all group together in the evolutionary t...cholocating cousins, the fruit bats. This has rais...s evolved more than once, or whether the fruit bat...
(Date:9/4/2008)... Heidelberg, 5 September 2008 Even scientists de...ttle surprise that the media also have various way... new study appearing in the October 2008 issue of ...based on the analysis of 300 articles in British a... The Daily Mail from the UK; and Aftenposten, Dagb...
(Date:9/4/2008)... A unique partnership between Syracuse University...tter access to life-saving vaccines for children l...e world. The Institute recently awarded $250,000 ...ssistant professor of chemistry in the College of ...ainst tetanus and rotavirus, a severe form of diar...
Breaking Biology News(10 mins):Old before their time? Aging in flies under natural vs. laboratory conditions 2Molecular evolution is echoed in bat ears 2What is a gene? 2Syracuse University partners with Serum Institute of India to develop vaccines for children 2Syracuse University partners with Serum Institute of India to develop vaccines for children 3Syracuse University partners with Serum Institute of India to develop vaccines for children 4CryoCath to present at Piper Jaffray and BMO Healthcare conferences 6960 1CryoCath to present at Piper Jaffray and BMO Healthcare conferences 6960 2Masimo Corporation Given Approval to Market the Masimo Rad 57 Pulse CO Oximeter in Japan 1960 1Masimo Corporation Given Approval to Market the Masimo Rad 57 Pulse CO Oximeter in Japan 1960 2Masimo Corporation Given Approval to Market the Masimo Rad 57 Pulse CO Oximeter in Japan 1960 3Masimo Corporation Given Approval to Market the Masimo Rad 57 Pulse CO Oximeter in Japan 1960 4Amsterdam Molecular Therapeutics Initiates Program for Late Stage Liver Cirrhosis and Reports Strong Progress in AMT 011 With Trial Fully Recruited an 6952 1Amsterdam Molecular Therapeutics Initiates Program for Late Stage Liver Cirrhosis and Reports Strong Progress in AMT 011 With Trial Fully Recruited an 6952 2Amsterdam Molecular Therapeutics Initiates Program for Late Stage Liver Cirrhosis and Reports Strong Progress in AMT 011 With Trial Fully Recruited an 6952 3Amsterdam Molecular Therapeutics Initiates Program for Late Stage Liver Cirrhosis and Reports Strong Progress in AMT 011 With Trial Fully Recruited an 6952 4Canceled 3A Homecare Rally in Contra Costa County 6949 1
(Date:9/5/2008)...G, Pa., Sept. 5 /PRNewswire-USNewswire/ -- Childre...r access to comprehensive,services to protect thei...n,in grants that were announced today by the Depar...vices for children and families, the department,be...ren,s Services Planning,initiative, ICSP, in 2004....
(Date:9/5/2008)..., Md., Sept. 5 /PRNewswire-USNewswire/ -- The Heal...day announced $39 million in grants to,increase an...centers., "These grants continue President Bush,s...whose services now reach more economically,vulnera...r before," HRSA,Administrator Elizabeth M. Duke sa...
(Date:9/5/2008)...ontrolled, but you need to know what triggers them...thDay News) -- If you are one of the 36 million Am...is nowhere in the United States that is free from ... shows. , Allergies don,t only happen in the sp...ell. In the fall, the most challenging cities to l...
(Date:9/5/2008)...N, Sept. 5 /PRNewswire-USNewswire/ -- Speaker Nanc...upport of the aims of the "Stand,Up to Cancer" tel...re is not a person in our country who has not seen...s 565,000 Americans annually, and each,year there ... must work,together to make eradicating the scourg...
Breaking Medicine News(10 mins):Health News:Pennsylvania Counties Receive Grants to Improve Services for Children 2Health News:HRSA Announces $39 Million in Grants to Expand, Improve Health Center Services 2Health News:No Place Safe From Allergies 2
Other Contentsjumpingjumpingjumpingjumpingwalkwalkwalkwalkwalkwalkwalkwalkchymecircularcircularcircularcircularcircularcircularcircularcircularcirculatorycirculatorycirculatorycirculatorycirculatorycirculatorycistroncladogenesis