Navigation Links


Tag: "applied" at biology news

Topical treatment shown to inhibit HIV and herpes simplex virus infection

...ol of Medicine researchers demonstrated that a gel applied in the vagina provides protection from both the human immunodeficiency virus (HIV) and the herpes simplex Virus. The study, presented at the 12th Conference on Retroviruses and Opportunistic Infections, is the first to show that a gel can retain anti...

Priming embryonic stem cells to fulfill their promise

... is comprised primarilyof just five proteins. They applied spots of all 32 possiblecombinations of the five proteins as engineered niches onto the surfaceof gel-coated slides, and then added mouse embryonic stem cells to theniches. After the cells were allowed to grow, the researchers assayedtheir progressio...

Transplantation Of Monkey Embryonic Stem Cells Reverses Parkinson Disease In Primates

...ns, technically simple andefficient, were recently applied to primate embryonic stem cells andresulted in the generation of large numbers of DA neurons. In theircurrent JCI study, Jun Takahashi and colleagues generated neurons frommonkey embryonic stem cells and exposed these cells to FGF20, a growthfactor t...

New Technique for Tracking Gene Regulators

...tantrole in certain cancers.“This technique can be applied to any protein that binds to specificsequences in the DNA and promises to be a very useful tool,?says Dunn.This research was funded by the Office of Biological and EnvironmentalResearch within the U.S. Department of Energy’s Office of Science, theNat...

The secret lives of whales

... Steve Palumbi of Stanford University. Palumbi has applied new genetic techniques to penetrate over a million years of whale history dating back to the middle of the last series of Ice Ages. Using whale samples from the Japanese meat market, where Antarctic minke whales killed for “scientific research?are l...

Dinosaur DNA? New Patent Covers Degraded DNA recovery

...lved crime scenes. "This discovery, when properly applied by our scientists, brings us closer to our goal of reconstructing genetic history. We now have the picture on the outside of the puzzle box, and by stringing together the pieces of aged DNA, we should be able to reconstruct genes from animals such as...

Automatic extraction of gene/protein biological functions from biomedical text

...or actually described functions in abstracts. When applied to the PUBMED, it extracted over 190 000 gene–GO relationships and 150 000 family–GO relationships for major eukaryotes. Availability: The extracted gene functions are available at http://prime.ontology.ims.u-tokyo.ac.jp ...

Gene variations explain drug dose required to control seizures

...We are beginning to understand how genetics can be applied to medicine in such a way as to reduce trial and error and improve quality of life for patients," he added. Epilepsy and seizures affect 2.5 million Americans of all ages, with approximately 181,000 new cases diagnosed each year. Phenytoin and carba...

Poplar trees redirect resources in response to simulated attack

...nt of Energy's Brookhaven National Laboratory have applied some of the same techniques used in medical imaging to track the distribution of nutrients in poplar trees in response to a simulated insect attack. The research provides new insights on a long-debated theory about how plants respond to environmental...

Development of portable infectious disease detector

...rs ofcells reliably. In the process, the group has applied for more than 12patents. Meanwhile, Pria has developed a micro-optical fluorescence spectroscopysystem and used it as the basis for a inexpensive male fertilitydetector that can be used in the home to measure sperm motility with anaccuracy comparabl...

Alcohol's effects on gene expression in the central nervous system

... of different DNA samples attached to it ?that are applied to brain function are just beginning in the field of alcoholism. Several years ago, it was impossible to analyze more than a handful of these genes, however, microarray technology has changed that." Symposium speakers at the June 2004 Research Socie...

New SARS Protein Linked To Important Cell Doorway

...D., assistant professor of molecular microbiology, applied those antibodies to cell cultures infected with the SARS virus, revealing that the virus does produce the orf7a protein. "We learned that the virus does make the protein, but we also got a big surprise when we looked at where the protein was," says ...

An entropy-based gene selection method for cancer classification using microarray data

...different runs and the gene selection algorithm is applied again to pare down the list of selected genes unti...tory accuracy of classification. The algorithm was applied to three different data sets and the results obtained were compared to work done by others using the...

Nano-Probes Allow an Inside Look at Cell Nuclei

...cell nuclei. "We took the tool Paul developed and applied it to a problem faced by biologists every day ?getting inside the nucleus, a desirable target because the cell's genetic information resides there," says Chen. First, they had to breach the nuclear membrane, which has pores that are only about 20 na...

Novel ultrafast laser detection of cancer cells also may improve understanding of stem cells

...y rapid and general method that potentially can be applied to cancer cells from solid tumors as well as hemat...urther interest is that the biocavity laser may be applied not only to identifying the spectra associated with cancer cells but also those associated with stem...

New research indicates a 'troubled' greenhouse is brewing

...ip between seasonality and rainfall in soils, then applied the same techniques to buried soils spanning the ancient greenhouse event. "This is known to have been a time of high atmospheric carbon dioxide from studies of the breathing pores in fossil leaves," he explains. "At that time, Wyoming warmed from a...

International trial of two microbicides begins

...ntly, scientists hope these agents--designed to be applied to the surface of the vagina to prevent sexually transmitted infections (STIs)--will one day be a key tool in the fight against HIV/AIDS. Women make up nearly half of all people living with HIV worldwide. "The majority of new cases of HIV infection ...

MetaChip provides quick, efficient toxicity screening of potential drugs

...ntly, scientists hope these agents--designed to be applied to the surface of the vagina to prevent sexually transmitted infections (STIs)--will one day be a key tool in the fight against HIV/AIDS. Women make up nearly half of all people living with HIV worldwide. "The majority of new cases of HIV infection ...

Study of genomic DNA leads to new advances in cancer diagnostics

...ostics laboratories (such as Pap smears), could be applied to such a purpose. The authors also used flow cytometry to characterize melanomas of varying invasiveness. Further study will be required to determine the specificity and sensitivity of these methods before they are used in the clinical setting. Phy...

Measuring the impact of post-genomics on Mediterranean populations

...h? To achieve this, they continue, fundamental and applied research is needed and supported, stressing integrated, multidisciplinary and coordinated effort. The two-day workshop highlighted not only the impact of recent progress in genomics on human health in developing countries, but also identified the et...

1 2 3 4 5 6 7 8 9 10

Other Tagsattached 2attached 3attached 4attached 5attached 6attached 7attached 8attached 9attached 10faces 2faces 3brought 2brought 3brought 4brought 5brought 6brought 7brought 8glial 2abnormal 2abnormal 3abnormal 4abnormal 5abnormal 6abnormal 7abnormal 8abnormal 9abnormal 10
(Date:12/3/2009)...reef fish can undergo a personality change in warm...gesting that climate change may make some species ...of young damselfish on Australia,s Great Barrier R...ish are either consistently timid, or consistently...ven more marked as water temperatures rise. , A ...
(Date:12/3/2009)... dwellers must be included in the design of the up... a humanitarian crisis, according to a scientist a...Nature , Dr Simon Lewis argues that at least 50% o...hagen, known as REDD (Reducing Emissions from Defo...st dwellers directly, and their property rights as...
(Date:12/3/2009)... leads the world when it comes to investment in en...ing and Physical Sciences Research Council (EPSRC)...needed: "Scientific and engineering research has a...ar power solutions, but more investment is needed ... if we are to meet our carbon emission targets by ...
Breaking Biology News(10 mins):Fish with attitude: Some like it hot 2Forest deal at Copenhagen must avoid creating 'carbon refugees' 2Research is vital to a cleaner, greener, low carbon future 2Small optical force can budge nanoscale objects 14883 1Small optical force can budge nanoscale objects 14883 2MSC Appoints Linda Lane Senior VP Sales and Marketing 61578 1IEHP Ranks 232 in California Among Medicaid Health Plans 61573 1IEHP Ranks 232 in California Among Medicaid Health Plans 61573 2
(Date:12/4/2009)... The renowned Center for mind-body medi...g the only natural immuno-boosting herbal suppleme...rveda. , San Diego, Calif...nprecedented illness due to factors such as stress... millions of people around the world are looking f...
(Date:12/3/2009)... With a membership increase of more tha...ement not only as a milestone in its history, but ...ce. Most associations are experiencing a decline i...o;At a time when trade organizations across the na...experiencing unprecedented growth, signaling that ...
(Date:12/3/2009)...INNEAPOLIS, Dec. 3 Children,s Hosp...cipient of the 2009 Leapfrog Top Hospitals Award. ...ering care that is among the best in the nation wh...y. ,, The Leapfrog survey is the only national,...uding mortality rates for common procedures, infec...
(Date:12/3/2009)...EVERLY HILLS, Calif., Dec. 3 Chris...ivine Design Gala and Premier Shopping Event for P...at 50-70% off regular prices. The event kicks off...December 7, 2009, located at 9900 Wilshire Bouleva...rnia. Please visit www.divinedesign.org for mor...
(Date:12/3/2009)...erforms widely used sulfonylureas, but each patien...RSDAY, Dec. 3 (HealthDay News) -- A class of drug...abetes is associated with a higher risk of dying a...n, researchers say. , , Sulfonylureas, long a m... than metformin in a study of oral anti-diabetes d...
Breaking Medicine News(10 mins):Health News:The Chopra Center for Wellbeing Launches Vedamune: An Ayurvedic Supplement to Support The Immune System 2Health News:Florida Medical Association Marks Record Membership Growth 2Health News:Children's Hospitals and Clinics of Minnesota Receives National Recognition for Quality and Efficiency 2Health News:Christian Audigier Represented at Divine Design for Project Angel Food 2Health News:Diabetes Drugs Go Head-to-Head in Study 2Health News:Diabetes Drugs Go Head-to-Head in Study 3
Other Contentsmicrocephalymidwifemidwifeheadachesheadachesheadachesheadachesheadachesmigrainesmigrainesmigrainesmiliamiliaria