Navigation Links


Tag: "role" at biology news

A gene's first 'kiss' sets off that affair known as puberty

...nhibits puberty's onset. To better understand what role GPR54 plays in the initiation of puberty, as well as learn about KiSS-1, which in earlier rodent studies had been identified as a molecule that activates a signal receptor of GPR54, the researchers looked to the nonhuman primate, the only animal with...

Bioartificial kidney under study at MCG

...horus, stimulate red blood cell production, play a role in blood pressure regulation and clear and metabolize cytokines that help direct the immune system. The new device for kidney failure adds billions of kidney cells that can perform many of these important kidney functions. Human proximal tubule cell...

Viral DNA sequence a possible trigger for breast cancer

...in Barr virus and Kaposi's sarcoma virus, but what role this sequence plays in cancer development has remained unexplored. Katz and colleagues now show that this sequence is contained in the Env protein of MMTV and show that expression of Env in mouse breast cells transforms them. This study puts the spo...

Molecular biology fills gaps in knowledge of bat evolution

...ccording to Springer. Bats play a major ecological role as plant pollinators and insect predators. For Springer, this latest research is significant because it shows that molecular information can contribute to resolving and illuminating long-standing problems in evolutionary biology. The current findin...

A new mechanism of regulating RNA degradation

..., but investigators now know that it plays a major role in regulating the life span of numerous RNAs, and thus controls gene activity. To better understand what controls the NMD system, Maquat and her postdoctoral fellow, Yoon Ki Kim, Ph.D., used a critical component of the NMD complex, Upf1, as bait in ...

FDA Approves Human Hookworm Vaccine for Phase I Safety Trials

..., but investigators now know that it plays a major role in regulating the life span of numerous RNAs, and thus controls gene activity. To better understand what controls the NMD system, Maquat and her postdoctoral fellow, Yoon Ki Kim, Ph.D., used a critical component of the NMD complex, Upf1, as bait in ...

Deficient DNA Repair Capacity Associated With Increased Risk Of Breast Cancer

...c community will be able to clearly understand the role of DNA repair capacity in the development of cancer and possibly to develop interventions to reduce cancer incidence and mortality," they write. ...

Spleen may be source of versatile stem cells

...wts and sponges. Combining theknowledge of Hox11's role in those animals with what we'd found aboutislet cell regeneration in mice helped us find this previously unknownexample of normal, controlled Hox11 expression in an adult mammal."Co-authors of the SAGE KE report are first author Shohta Kodama, MD,Ph...

Genes In The Interferon System Important In Systemic Lupus Erythematosus

...transcription factor, which also plays animportant role in regulating the interferon effect. Further functionalanalyses will be necessary to map the molecular mechanisms in detail.Besides the Rheumatology Clinic at Uppsala Akademiska Hospital,hospitals in UmeƄ and Lund, in Sweden, and several hospitals in...

Quantum Dots Research Leads to New Knowledge about Protein Binding in Plants

...wingpollen tube tip. This protein plays a critical role along with anotherprotein (chemocyanin) in guiding sperm-laden pollen tubes to the eggsfound in ovules. Applyingnanoparticles for imaging the protein localization revealed informationthat could not be observed previously by conventional imagingtechn...

W.M. Keck Foundation funds study of friendly microbes

...ience into patient care. The CGS plays a catalytic role in helping to devise new ways to translate the genetic data obtained from genome sequencing projects to allow researchers to better understand the evolution and diversity of life on Earth, as well as help create new methods to diagnose and treat pati...

Topical treatment shown to inhibit HIV and herpes simplex virus infection

...HIV transmission, and genital herpes plays a major role in the sexual spread of HIV. The researchers conducted a prospective, randomized, double blind, placebo-controlled study among 20 HIV-infected women to assess the antiviral activity of PRO 2000 in cervicovaginal lavage (CVL) fluid collected before a...

Genome of deadly amoeba shows surprising complexity, evidence of lateral gene transfer

...t Claire M. Fraser, who supervised the Institute's role in the project. E. histolytica is a voracious predator of bacteria and shares a close relationship in the human gut with its bacterial neighbors. Because the parasite uses the same methods to kill bacteria as it uses to damage human cells and cause ...

Antarctic ice shelf retreats happened before

...uggests that the ocean may play a more significant role in destroying them than previously thought. The U... there has been a suspicion for some time that the role of the ocean may have been underestimated. This is some of the first evidence that a shift in ocean ...

Newly-discovered class of genes determines ?and restricts ?stem cell fate

...cal factor or complex of factors to have this dual role may represent a new general paradigm for developmental and stem-cell biology. "My idea is that this is a new family of genes--they can both determine the cell type, but also put the breaks on differentiation," says Epstein. "We have named them pangen...

Timing is everything: First step in protein building revealed

...diac hypertrophy, or an enlargedheart.While eIF1's role in cardiac hypertrophy remains a mystery, the newd...s no small task -- roughly 27 bits likeeIF1 play a role at one point or another. To tackle the problem, Lorschand his colleagues move between "timing" studi...

Researchers Uncover Key Step In Manufacture of Memory Protein

A cellular enzyme appears to play a crucial role in the manufacture of a protein needed for long-term memory, according to a team of researchers led by scientists at the National Institute of Child Health and Human Development of the National Institutes of Health. The protein is known as mBDNF, wh...

Research advances quest for HIV-1 vaccine

...e virus. The gp41 protein is thought to play a key role in mediating entry of HIV-1 into human cells. A research group led by Drs. Dennis R. Burton and Ian A. Wilson from The Scripps Research Institute in La Jolla, California performed a study examining the detailed molecular structure of the complex for...

Scientists detect probable genetic cause of some Parkinson's disease cases

...nt. Scientists have longsuspected genetics plays a role in the onset of the disease. In thesestudies, the investigators found that a mutation in the gene LRRK2appears to occur in at least one of every 60 people who have thedisease. Overall, the mutation could be responsible for up to 5 percentof Parkinson...

Newly discovered virus linked to childhood lung disorders and Kawasaki disease

...h a causative agent isunidentified, and may have a role in Kawasaki disease, the most commoncause of acquired heart disease in children in developed countries. In the first of two studies, Jeffrey S. Kahn and co-workers at YaleUniversity used molecular probes targeting a gene that is common inhuman and a...

1 2 3 4 5 6 7 8 9 10

Other Tagslocals 2formulate 2formulate 3ministers 2ministers 3ministers 4ministers 5ministers 6ministers 7nor 2nor 3nor 4nor 5nor 6nor 7nor 8nor 9nor 10neither 2neither 3neither 4neither 5neither 6neither 7neither 8neither 9connecting 2
(Date:12/3/2009)... the 1980s, Harald zur Hausen and his co-workers discovered ... cancer. Scientists soon found out how these pathogens cause ... main culprits are viral proteins E6 and E7. Both ... cell growth. , Professor Dr. Frank Rsl and ...
(Date:12/3/2009)... its 32nd year, the CTRC-AACR San Antonio Breast Cancer ... science and world leaders from industry and academia with ... year, more than 8,500 scientists and other professionals will ... San Antonio from Dec. 9-13, 2009. The symposium is ...
(Date:12/3/2009)... be included in the design of the upcoming forest deal ... to a scientist at the University of Leeds. , ... that at least 50% of the carbon credit payments to ... Deforestation and Degredation), should be made to forest dwellers directly, ...
Breaking Biology News(10 mins):Papillomavirus silences innate immune response 2CTRC-AACR San Antonio Breast Cancer Symposium continues to expand 2Forest deal at Copenhagen must avoid creating 'carbon refugees' 2CardioDynamics Agrees to be Acquired by SonoSite for 241 35 Per Share 12547 1CardioDynamics Agrees to be Acquired by SonoSite for 241 35 Per Share 12547 2CardioDynamics Agrees to be Acquired by SonoSite for 241 35 Per Share 12547 3CardioDynamics Agrees to be Acquired by SonoSite for 241 35 Per Share 12547 4CardioDynamics Agrees to be Acquired by SonoSite for 241 35 Per Share 12547 5Masimo Debuts New Rad 8 28R 29 Pulse Oximeter to Largest Gathering of Sleep Specialists From Around the World at SLEEP 2009 48377 1Masimo Debuts New Rad 8 28R 29 Pulse Oximeter to Largest Gathering of Sleep Specialists From Around the World at SLEEP 2009 48377 2Masimo Debuts New Rad 8 28R 29 Pulse Oximeter to Largest Gathering of Sleep Specialists From Around the World at SLEEP 2009 48377 3Masimo Debuts New Rad 8 28R 29 Pulse Oximeter to Largest Gathering of Sleep Specialists From Around the World at SLEEP 2009 48377 4Masimo Debuts New Rad 8 28R 29 Pulse Oximeter to Largest Gathering of Sleep Specialists From Around the World at SLEEP 2009 48377 5DaVita Commends Kidney Care Partners for Launch of PEAK Campaign 48372 1DaVita Commends Kidney Care Partners for Launch of PEAK Campaign 48372 2DaVita Commends Kidney Care Partners for Launch of PEAK Campaign 48372 3
(Date:12/6/2009)... Sickle cell disease, a condition characterized by deformed ... the most common genetic blood disorders affecting millions ... 70,000 Americans.(1) Research presented today at the 51st ... highlights intriguing studies on the acute danger that ... blood disorder, evaluations of both new and standard ...
(Date:12/6/2009)... Attorney Joseph W. Belluck of Belluck & Fox, LLP says dangerous ... holiday seasons. , ... New York, NY (PRWEB) December ... holiday season, they should be alert to reports of recalls due ... injury lawyer., , ,“Close to 230,000 children visit hospital emergency rooms ...
(Date:12/5/2009)... Is Most Challenging-- ,, PHILADELPHIA and NEW ... genes, dubbed partner genes, that fuse with another gene ... By more accurately defining specific partner genes, researchers expect ... treatments. ,, Oncologists also aim to use this ...
(Date:12/5/2009)... announced the launch of International Solutions, an innovative new international private ... UK equivalent. In addition to offering customers the flexibility to add ... and budgets, International Solutions enables customers to tailor their benefits to ... , ...
(Date:12/4/2009)... LLP employees came together in more than 90 offices nationwide ... the audit, tax and advisory firm,s support for literacy with ... firm,s long history of volunteerism. Instead of holiday parties, our ... holidays for some children," said Tim Flynn, Chairman of KPMG. ...
Breaking Medicine News(10 mins):Health News:Studies Investigate Emerging Trends and Treatment Options for Patients With Sickle Cell Disease 2Health News:Studies Investigate Emerging Trends and Treatment Options for Patients With Sickle Cell Disease 3Health News:Studies Investigate Emerging Trends and Treatment Options for Patients With Sickle Cell Disease 4Health News:Studies Investigate Emerging Trends and Treatment Options for Patients With Sickle Cell Disease 5Health News:Studies Investigate Emerging Trends and Treatment Options for Patients With Sickle Cell Disease 6Health News:Studies Investigate Emerging Trends and Treatment Options for Patients With Sickle Cell Disease 7Health News:Studies Investigate Emerging Trends and Treatment Options for Patients With Sickle Cell Disease 8Health News:Studies Investigate Emerging Trends and Treatment Options for Patients With Sickle Cell Disease 9Health News:Belluck & Fox Law Firm Urges Caution When Buying Toys This Holiday Season 2Health News:Belluck & Fox Law Firm Urges Caution When Buying Toys This Holiday Season 3Health News:New Gene Findings Will Help Guide Treatment in Infant Leukemia 2Health News:New Gene Findings Will Help Guide Treatment in Infant Leukemia 3Health News:New Gene Findings Will Help Guide Treatment in Infant Leukemia 4Health News:AVIVA's Private Health Insurance Products Solutions Go International 2Health News:KPMG Employees Provide 'Holiday Bear Hugs' and Books in Firmwide Service Day for Children 2
Other Contentsjumpingjumpingjumpingjumpingwalkwalkwalkwalkwalkwalkwalkwalkchymecircularcircularcircularcircularcircularcircularcircularcircularcirculatorycirculatorycirculatorycirculatorycirculatorycirculatorycistroncladogenesis