Navigation Links


Tag: "protect" at biology news

Deficient DNA Repair Capacity Associated With Increased Risk Of Breast Cancer

... DNA repair is the system of defenses designed to protect the integrity of the genome. Studies have suggested that deficiency in cells' capacity for DNA repair contributes to the accumulation of DNA damage and accelerates the genetic changes involved in carcinogenesis. To evaluate whether reduced DNA repai...

Genes In The Interferon System Important In Systemic Lupus Erythematosus

...us."We found that genetic variants of thyrosinkase protect against SLE. Itprobably has an inhibited function that blocks the interferon effect.It is therefore possible to imagine the development of methods oftreatment for SLE based on blocking the function of the thyrosinkinaseenzyme," explains Lars Rönnblom...

Dysentery uses 'sword and shield' to cause infection

...on the surface of the bacteria acts as a shield to protect the dysentery bacterium from being destroyed by the body's immune system. Dr Christoph Tang, from Imperial College London, and one of the researchers, comments: "This is the first description of bacteria able to use this 'sword and shield' approach,...

New binding target for oncogenic viral protein

...activates some of the most important proteins that protect cells against malignant transformation, including tumor suppressor proteins p53 and pRb. In the Journal of Biological Chemistry paper, Dr. Welcker and Dr. Bruce Clurman report that T antigen also binds to another tumor suppressor, Fbw7. This protein...

Genome of deadly amoeba shows surprising complexity, evidence of lateral gene transfer

...istolytica, and what acquired immune responses can protect people from re-infection. Says Petri: "The genome project has spawned rapid discovery of the parasite's mechanisms for replication, gene expression, motility, metabolism, and the killing of host cells." ### The Institute for Genomic Research (TIGR)...

Plants, animals share molecular growth mechanisms

... allow researchers to design plants better able to protect themselves from insects and disease. "These genes and their proteins are required for normal development and for normal cell-to-cell adhesion," Szymanski said. "They affect the growth of the whole plant and also the shape and size of types of cells ...

Study Links Ebola Outbreaks To Animal Carcasses

...win' opportunity by using this information to both protect endangered apes from illegal hunting and to protect humans from deadly outbreaks." The paper provides definitive proof for the assumption that Ebola mo...

Bound for destruction: Ubiquitination protects against improper Notch signaling

...ve identified the means by whichunstimulated cells protect the Notch receptor from activation.Recent studies by other labs had shown that a number of stages in theNotch cascade were subject to ubiquitination, in which proteins aretagged by a complex of ubiquitin proteins. This system is best knownfor its fun...

Discovery of key protein's shape could lead to improved bacterial pneumonia vaccine

...uld solve a problem that now hinders ourability to protect children from this infection,?Tuomanen said.Current pneumonia vaccines designed to protect adults against more thantwo dozen strains of S. pneumoniae do not work in young children. Adultvacci...

New comparative toxicogenomics database

...uld solve a problem that now hinders ourability to protect children from this infection,?Tuomanen said.Current pneumonia vaccines designed to protect adults against more thantwo dozen strains of S. pneumoniae do not work in young children. Adultvacci...

ASU researchers finds novel chemistry at work to provide parrot's vibrant red colors

...i-oxidants to quench free radicals and potentially protect cells and tissues in the body from oxidative damage. Now, McGraw says, he's interested in learning more about the connection between the red colors and anti-oxidants within and among parrot species, as well as "to specifically explore the balance of...

Transport System Smuggles Medicines Into Brain

...i-oxidants to quench free radicals and potentially protect cells and tissues in the body from oxidative damage. Now, McGraw says, he's interested in learning more about the connection between the red colors and anti-oxidants within and among parrot species, as well as "to specifically explore the balance of...

Gene Therapy For Parkinson's Disease Moves Forward In Animals

... that introduction can provide insight into how to protect neural cells. This is showing us a new way to approach the problem.?/p> Parkinson's disease is caused by the death of brain cells that produce a vital chemical known as dopamine, which carries messages that tell the body how and when to move. In ...

Why do insects stop 'breathing'? To avoid damage from too much oxygen, say researchers

...biomaterial due to excess oxygen -- to tissues. To protect their bodies, insects like grasshoppers discontinue breathing. "We propose that most insects stop breathing in order to lower their internal oxygen concentration to physiologically safe levels, and that they then substantially reduce gas exchange to...

Antibodies from plants protect against anthrax

...he infected plants and tested for their ability to protect mice against anthrax infection. The plant-produced antibodies were just as effective as the antibodies produced by human cells from immunized individuals. The antibodies can be used either before exposure to prevent infection or after exposure as tr...

Photos show jaguar vamping for camera

.... The Wildlife Conservation Society is working to protect jaguars throughout their range with projects in several Latin American countries designed to safeguard healthy populations of this spectacular big cat. ...

Gene therapy for Parkinson's disease moves forward in animals

... that introduction can provide insight into how to protect neural cells. This is showing us a new way to approach the problem." Parkinson's disease is caused by the death of brain cells that produce a vital chemical known as dopamine, which carries messages that tell the body how and when to move. In tests ...

New Insights Into HIV Immunity Suggest Alternative Approach to Vaccines

...e innate B cells, the body destroys the B cells to protect against autoantibodies that could cause autoimmune disease or other harm. The second immune system category is adaptive B cell immunity, a slower response that creates powerful, pathogen-specific antibodies and provides lasting immunity. The body's ...

Antibiotic might fight HIV-induced neurological problems

...researchers have reported that this antibiotic can protect brain cells in animal models of other diseases -- multiple sclerosis, amyotrophic lateral sclerosis, Alzheimer's disease, stroke and more. The drug is being tested in early clinical trials for some non-HIV-related conditions. "Last year we discovere...

Norovirus, AIDS vaccine and Hepatitis Virus

...may not be able to prevent HIV infection, it could protect against progression to full-blown AIDS. Researcher... the Journal of Virology. Developing a vaccine to protect against HIV in attempt to gain control of the AIDS pandemic is a top priority for researchers throug...

1 2 3 4 5 6 7 8 9 10

Other Tagslightly 2inexpensive 2inexpensive 3inexpensive 4inexpensive 5inexpensive 6applied 2applied 3applied 4applied 5applied 6applied 7applied 8applied 9applied 10free 2free 3free 4free 5free 6free 7free 8free 9free 10develops 2develops 3develops 4develops 5Other Contentschloroplastschloroplastschordateschordatejumpingjumpingjumpingjumpingwalkwalkwalkwalkwalkwalkwalkwalkchymecircularcircularcircularcircularcircularcircularcircularcircular