Navigation Links


Tag: "parasites" at biology news

Ecological destruction fuels emerging diseases

...ical damage also endangers human health by turning parasites into "evolutionary land mines." Dr. Daniel (Dan) ... jaguars. For his part, Dr. Brooks has looked for parasites in more than 4,000 individuals from species ranging from frogs to deer. So far, he has found more th...

Researchers reveal the infectious impact of salmon farms on wild salmon

...here the study took place. In Europe, transfer of parasites is generally accepted as a significant threat to a...balance. When infection rates are high enough, the parasites feed on the fish at rates greater than the fish can feed itself, literally eating the fish alive. Ad...

A bacterial genome reveals new targets to combat infectious disease

...are at risk for infection with filarial nematodes, parasites that cause elephantiasis, African river blindness, and other debilitating diseases in more than 150 million people worldwide. The nematodes themselves play host to bacteria that live within their cells, but in this case, the relationship is classic m...

Scientists reveal molecular secrets of the malaria parasite

...human/mouse). Thatmay represent a mechanism by the parasites to repulse the attack of thehost's immune system. * For the first time, scientists were able tostudy the protein expression of the parasite in the mosquito vector.Researchers hope this will shed light on how the mosquito and parasiteinteract, and per...

UCSD discovery may help extend life of natural pesticide

...against roundworms that parasitize humans. "These parasites infect nearly one-third of the human population and pose a significant health problem in developing countries," said Aroian. "Perhaps one-day vertebrate-safe Bt toxins could be used as human therapies against these parasites." Griffitts and Aroian c...

In the migratory marathon, parasitized monarchs drop out early

...hether these long journeys can limit the spread of parasites by weeding out diseased animals. Monarch butterfli...study demonstrated that seemingly small effects of parasites on their hosts could have a much larger impact when combined with the stresses of long-distance migr...

Protein offers way to stop microscopic parasites in their tracks

...to stop or slow cell invasion by malaria and other parasites known as apicomplexans. Results of the study will...of water-borne disease in the world. "These other parasites are more devastating in terms of the number of people they affect, but they're somewhat harder to wo...

Yale researchers identify molecule for detecting parasitic infection in humans

...provides insight into understanding how infectious parasites interface with the immune system--a problem of great scientific and clinical importance. Most infections are caused by bacterial or viral microorganisms that produce molecules quite different from those produced by humans and other eukaryotic organi...

Molecular models advance the fight against malaria

...artmouth Medical School, demonstrating how malaria parasites form mutations that make them stubbornly resistant...market, there is significant evidence that malaria parasites are quickly developing resistance to that drug as well. According to WHO estimates, 40% of the world...

Reducing malarial transmission in Africa

...t might reduce selective transmission of resistant parasites in treated patients. Citation: Sutherland CJ, Ord R, Dunyo S, Jawara M, Drakeley CJ, et al. (2005) Reduction of malaria transmission to Anopheles mosquitoes with a six-dose regimen of coartemether. PLoS Med 2(4): e92. ...

A human parasite with a streamlined mitochondrion

...owever, some eukaryotic cells, including important parasites of humans--such as Entamoeba histolytica, the causal agent of amoebic dysentery--live in environments that are too oxygen poor to support this process. Nevertheless, Entamoeba still contains a somewhat mysterious organelle, called a mitosome, that is...

OneWorld Health drug receives 'Orphan' designation from U.S. and European regulatory agencies

...transmitted by sand flies, which spread leishmania parasites that attack internal organs. An estimated 1.5 million people worldwide are currently infected; the number of new VL cases per year is estimated at 500,000; and as many as 200,000 people die annually. More than 90 percent of VL cases occur in five cou...

New strategies to reduce hospital-aquired infections

...waterborne microbes- -bacteria, viruses, fungi and parasites --can enter into the healthcare environment in several ways: direct contact with or ingestion of drinking water or ice, breathing aerosols from showers and faucets and even from improperly reprocessed medical devices. As hospitals increasingly recogn...

Distributed Basic Local Alignment Search Toolkit (W.ND-BLAST)

...waterborne microbes- -bacteria, viruses, fungi and parasites --can enter into the healthcare environment in several ways: direct contact with or ingestion of drinking water or ice, breathing aerosols from showers and faucets and even from improperly reprocessed medical devices. As hospitals increasingly recogn...

Natural Killers Could Lead to New Hepatitis Treatments

...hepatitis. Hepatitis can be a reaction to viruses, parasites such as malaria or other infections. Learning to “call off?the NKT cell's pursuit and attack could offer a treatment for hepatitis and associated complications. The researchers, led by Dan Littman, a Howard Hughes Medical Institute investigator at N...

Newly discovered protein an important tool for sleeping sickness research

...gen, thus assuring the long-term survival of these parasites within their hosts. The trypanosome has approximately 1,000 different VSG genes, but only expresses one at a time while the others are somehow silenced. This genetic trick, called antigenic variation, has severely limited sleeping sickness treatment ...

Breakthrough System for Understanding Ocean Plant Life Announced

...gen, thus assuring the long-term survival of these parasites within their hosts. The trypanosome has approximately 1,000 different VSG genes, but only expresses one at a time while the others are somehow silenced. This genetic trick, called antigenic variation, has severely limited sleeping sickness treatment ...

Malaria mechanism revealed

...ecular structure of a protein that enables malaria parasites to invade red blood cells, researchers have uncove... children. The disease is caused by mosquito-borne parasites of the genus Plasmodium (primarily Plasmodium falciparum). Following the initial stages of infection...

Gene expands malaria's invasion options

...und only two genes whose activity differed between parasites that used sialic acid and those that did not. The ...0 times more active in the sialic acid-independent parasites than in those that needed the sugar for cell entry. These results suggested that activation of th...

Measuring hidden parasites in falciparum malaria

A new technique for measuring hidden malaria parasites and assessing severity of disease is described in ...y of disease is measured by counting the number of parasites in the blood under the microscope, but this method ignores parasites which are in red blood cells tr...

1 2 3 4 5

Other Tagsteacher 2teacher 3dried 2dried 3fruits 2prolong 2
(Date:11/24/2009)...4, 2009) New research on bacterial communities th... predictable temporal patterns, suggesting that sc...r monitoring climate change in the polar regions. ... of the National Academy of Sciences Early Editio...ers shifted synchronously over time, correlating w...
(Date:11/23/2009)...sents strong evidence that the "synergistic" effec...elated pollution and indoor endotoxin causes more ...osure alone. , Environmental health scientists...edicine have shown that children exposed to both h... endotoxin during early life are six times more li...
(Date:11/23/2009)...mber 23, 2009 Applied mathematicians dissected th...ia ), a characteristic long leaf with a saddle-lik...the edges. The simple cause of the lily,s fan-like...ring differential growthwas revealed by using an e..., Haiyi Liang, a postdoctoral student at Harvard...
Breaking Biology News(10 mins):Researchers establish common seasonal pattern among bacterial communities in Arctic rivers 2Exposure to both traffic, indoor pollutants puts some kids at higher risk for asthma later 2The cause behind the characteristic shape of a long leaf revealed 2Health Care Training a Great Option for Back to School Career Seekers 56327 1Health Care Training a Great Option for Back to School Career Seekers 56327 2Pew Commissioned Poll Finds Nine in Ten Iowa Voters Support More Government Oversight of Food 56323 1Pew Commissioned Poll Finds Nine in Ten Iowa Voters Support More Government Oversight of Food 56323 2Pew Commissioned Poll Finds Nine in Ten Iowa Voters Support More Government Oversight of Food 56323 3Hissey Kientz LLP Urges Patients To Heed FDA Warning About Phospho soda Products 56320 1Hissey Kientz LLP Urges Patients To Heed FDA Warning About Phospho soda Products 56320 2Hissey Kientz LLP Urges Patients To Heed FDA Warning About Phospho soda Products 56320 3Hissey Kientz LLP Urges Patients To Heed FDA Warning About Phospho soda Products 56320 4
(Date:11/29/2009)...ment equals a $41,000 pay raise, researchers say ,... Psychological therapy may be much more effective ...ning a lottery prize, suggests an English study. ,...le who provided information about their mental wel...rom a $1,329 course of therapy was so significant ...
(Date:11/29/2009)...ealthcare,s uncertain future and rising costs open...Affordable Acupuncture Scottsdale answers the call...2009 -- Affordable Acupuncture, LLC opened in Scot...t with enthusiasm and gratitude. Its increasing po...o things, need and cost. "As far as I’...
(Date:11/28/2009)...nsider change after 30-minute psychosocial interve...HealthDay News) -- A program that gets persistent ...ir dangerous behavior may lead to significant and ... The new study included 184 men and women with two...ere randomly assigned to one of two interventions....
(Date:11/27/2009)...RNewswire-FirstCall/ -- GSI Group Inc. (Pink Sheet...technology products and semiconductor systems, tod...,s shareholders has been scheduled for Friday, Apr... will be announced in due course. As previously a...e from Stephen Bershad, a holder of greater than t...
(Date:11/27/2009)...-USNewswire/ -- Considered a highly risky and cont...id organ transplantation is now a life-saving main...nd women who gathered at the Winspear Opera House ...edical centers around the world to celebrate the 2...itute (BRTI), one of the pioneers of solid organ t...
Breaking Medicine News(10 mins):Health News:Psychotherapy Can Boost Happiness More Than Money: Study 2Health News:Affordable Acupuncture Greeted with Open Arms by Scottsdale and Phoenix Communities 2Health News:Drunk Drivers May Respond to Brief Motivational Interview 2Health News:GSI Group Calls Shareholders Meeting 2Health News:Organ Transplant Pioneers Celebrate Baylor Regional Transplant Institute's 25th Anniversary 2Health News:Organ Transplant Pioneers Celebrate Baylor Regional Transplant Institute's 25th Anniversary 3
Other Contentschloroplastschloroplastschordateschordatejumpingjumpingjumpingjumpingwalkwalkwalkwalkwalkwalkwalkwalkchyme