Navigation Links


Tag: "minuscule" at biology news

Technique monitors thousands of molecules simultaneously

...fashioned way ?selectively harnessing thousands of minuscule electrodes on a tiny computer chip that do chemical reactions and yield molecules that bind to receptor sites. Kevin Moeller, Ph.D., Washington University professor of chemistry in Arts & Sciences, is doing this so that the electrodes on the chip...

Study shows isolation of stem cells may lead to a treatment for hearing loss

...r a whisper. These hair cells differ in length by minuscule amounts and are set in motion by specific frequencies of sound. We hear this sound because this motion induces the hair cell to release an electrical impulse which passes along the auditory nerve to the brain. If the sound is too loud, the hair cel...

Pressured by predators, lizards see rapid shift in natural selection

...studied populations of the lizard Anolis sagrei on minuscule islands, or cays, in the Bahamas. They introduced to six of these cays a larger, predatory lizard (Leiocephalus carinatus) commonly found on nearby islands and known as a natural colonizer of small cays. The scientists kept six other control cays pre...

'Micro-boxes' of water used to study single molecules

...ST) have demonstrated the use of water droplets as minuscule "boxes" for small numbers of biomolecules. The unusually simple containment method may enable easier experiments on single molecule dynamics and perhaps lead to the development of molecule-sorting devices that might be used for medical screening or b...

Nanowires can detect molecular signs of cancer, scientists find

Use of minuscule devices to spot cancer markers could lead to ultra... to this exceptional accuracy and sensitivity, the minuscule devices also promise to pinpoint the exact type of cancer present with a speed not currently availab...

Molecular Motors Cooperate In Moving Cellular Cargo, Study Shows

...ng filaments called microtubules. To measure such minuscule motion, Selvin and colleagues at Illinois developed a technique called Fluorescence Imaging with One Nanometer Accuracy. The technique can locate a fluorescent dye to within 1.5 nanometers (one nanometer is a billionth of a meter, or about 10,000 tim...

Scientists find fossil proof of Egypt's ancient climate

...years. Normal rainfall in the area they study is a minuscule 0.7 of a millimeter per year, but there is evidence that the rainfall amounts in the region have gotten up to as much as 600 millimeters per year, "not enough to make it a paradise," Smith said, "but enough to turn a barren environment into a classic...

1

Other Tagstied 2tied 3tied 4tied 5monitoring 2monitoring 3monitoring 4monitoring 5monitoring 6monitoring 7monitoring 8monitoring 9monitoring 10neglected 2neglected 3along 2along 3along 4along 5along 6along 7along 8along 9along 10floating 2
(Date:9/5/2008)..., Evolutionary studies of aging typically ut...mice) under benign conditions constant temperatur...in the laboratory. Oddly enough, very little is kn...ressful natural environments. Could it be that the... slowly in captive luxury than do their wild cousi...
(Date:9/5/2008)... Bats, ability to echolocate may have evolved mor...week by Queen Mary, University of London scientist...te do not all group together in the evolutionary t...cholocating cousins, the fruit bats. This has rais...s evolved more than once, or whether the fruit bat...
(Date:9/4/2008)... Heidelberg, 5 September 2008 Even scientists de...ttle surprise that the media also have various way... new study appearing in the October 2008 issue of ...based on the analysis of 300 articles in British a... The Daily Mail from the UK; and Aftenposten, Dagb...
(Date:9/4/2008)... A unique partnership between Syracuse University...tter access to life-saving vaccines for children l...e world. The Institute recently awarded $250,000 ...ssistant professor of chemistry in the College of ...ainst tetanus and rotavirus, a severe form of diar...
Breaking Biology News(10 mins):Old before their time? Aging in flies under natural vs. laboratory conditions 2Molecular evolution is echoed in bat ears 2What is a gene? 2Syracuse University partners with Serum Institute of India to develop vaccines for children 2Syracuse University partners with Serum Institute of India to develop vaccines for children 3Syracuse University partners with Serum Institute of India to develop vaccines for children 4CryoCath to present at Piper Jaffray and BMO Healthcare conferences 6960 1CryoCath to present at Piper Jaffray and BMO Healthcare conferences 6960 2Masimo Corporation Given Approval to Market the Masimo Rad 57 Pulse CO Oximeter in Japan 1960 1Masimo Corporation Given Approval to Market the Masimo Rad 57 Pulse CO Oximeter in Japan 1960 2Masimo Corporation Given Approval to Market the Masimo Rad 57 Pulse CO Oximeter in Japan 1960 3Masimo Corporation Given Approval to Market the Masimo Rad 57 Pulse CO Oximeter in Japan 1960 4Amsterdam Molecular Therapeutics Initiates Program for Late Stage Liver Cirrhosis and Reports Strong Progress in AMT 011 With Trial Fully Recruited an 6952 1Amsterdam Molecular Therapeutics Initiates Program for Late Stage Liver Cirrhosis and Reports Strong Progress in AMT 011 With Trial Fully Recruited an 6952 2Amsterdam Molecular Therapeutics Initiates Program for Late Stage Liver Cirrhosis and Reports Strong Progress in AMT 011 With Trial Fully Recruited an 6952 3Amsterdam Molecular Therapeutics Initiates Program for Late Stage Liver Cirrhosis and Reports Strong Progress in AMT 011 With Trial Fully Recruited an 6952 4Canceled 3A Homecare Rally in Contra Costa County 6949 1
(Date:9/5/2008)...G, Pa., Sept. 5 /PRNewswire-USNewswire/ -- Childre...r access to comprehensive,services to protect thei...n,in grants that were announced today by the Depar...vices for children and families, the department,be...ren,s Services Planning,initiative, ICSP, in 2004....
(Date:9/5/2008)..., Md., Sept. 5 /PRNewswire-USNewswire/ -- The Heal...day announced $39 million in grants to,increase an...centers., "These grants continue President Bush,s...whose services now reach more economically,vulnera...r before," HRSA,Administrator Elizabeth M. Duke sa...
(Date:9/5/2008)...ontrolled, but you need to know what triggers them...thDay News) -- If you are one of the 36 million Am...is nowhere in the United States that is free from ... shows. , Allergies don,t only happen in the sp...ell. In the fall, the most challenging cities to l...
(Date:9/5/2008)...N, Sept. 5 /PRNewswire-USNewswire/ -- Speaker Nanc...upport of the aims of the "Stand,Up to Cancer" tel...re is not a person in our country who has not seen...s 565,000 Americans annually, and each,year there ... must work,together to make eradicating the scourg...
Breaking Medicine News(10 mins):Health News:Pennsylvania Counties Receive Grants to Improve Services for Children 2Health News:HRSA Announces $39 Million in Grants to Expand, Improve Health Center Services 2Health News:No Place Safe From Allergies 2
Other Contentsjumpingjumpingjumpingjumpingwalkwalkwalkwalkwalkwalkwalkwalkchymecircularcircularcircularcircularcircularcircularcircularcircularcirculatorycirculatorycirculatorycirculatorycirculatorycirculatorycistroncladogenesis