Navigation Links


Tag: "library" at biology news

Antarctic icebergs -- Hotspots of ocean life

...ed the data using the SIOExplorer-in-a-Box digital library system ( http://SIOExplorer.ucsd.edu ) and then stored the information in collections at SDSC for access and analysis by scientists now and in the future. Just getting to the icebergs was a challenge. First the scientists used satellite images to...

Technique monitors thousands of molecules simultaneously

...bing a receptor this way has been done by making a library of molecules, treating it with the receptor, washi...tle, Moeller saw a way of probing the binding of a library with a receptor without the need for washing by putting each member of the molecular library by an e...

Lighting up life: Cold Spring Harbor Protocols presents tips for creating glowing plants

...ivision. Both of these publications join a growing library of high-quality methods from Cold Spring Harbor Protocols that span a broad spectrum of topics essential to researchers across many disciplines. ...

Novel antigen-cloning technique may boost efforts to develop a melanoma vaccine

... With her new technique, Herlyn expresses the cDNA library in bacteriophages that are incubated with B cells from the same patient from whom the T cells were derived. Because B cells are antigen-presenting cells, once they have picked up, or "eaten," the phages, the B cells will express the peptides that are...

Genes and biomarkers that allow doctors to choose the right therapy for the right patient

...ers at Vanderbilt University are using a biomarker library of peptides to determine whether or not tyrosine k...ent surrounding the tumors. This phage displayed library ?called so after the bacteriophage viruses used to capture protein fragments ?was then isolated and ...

Discovery of an HIV inhibitor in human blood points to new drug class

...dy, the researchers sifted through a comprehensive library of small peptides that had been filtered from the blood of patients with chronic kidney failure during dialysis, in search of those with anti-HIV activity. After sorting the more than one million blood peptides into 300 fractions, they focused on one...

Bacterial response to oxidation studied as toxin barometer

...al damage in cell cultures. “If we can create a library of cellular response, we might have either a generic or a specific predictor,?said Brian Love, professor of materials science and engineering at Virginia Tech. “We don’t know yet because we haven’t tested other cell types.? Brian Love has been assi...

Knockout Mouse Project

...l Oakland Research Institute has a recombinant DNA library with more than 30 million DNA samples that are use...ams around the world. The research institute's DNA library has become a major resource for ongoing global research in the genetics of human diseases. The reco...

Genetic study of Neanderthal DNA reveals early split between humans and Neanderthals

...one and insert missing fragmented DNA and create a library of Neanderthal DNA. Unlike the libraries used to...ined only human DNA fragments, the Neanderthal DNA library is riddled with contamination from microbes that lived off the nutrients in the Neanderthal remains,...

Caterpillars tell us how bacteria cause disease

...ted the genome for this bacteria and created a DNA library of over 1,500 separate cloned fragments ?which covers most of the genome. They then inject the clones into Tobacco Hawkmoth Caterpillars to study the effects. Their work has shown that clones containing harmless genetic material are recognised and...

New biochip helps study living cells, may speed drug development

...that need less fertilizer," he said. "If you had a library of genes that were associated with high nitrogen-use efficiency -- thus making the plant need less nitrogen fertilizer -- you could transform a group of maize cells with these genes and then screen each cell to determine the most efficient. Then you ...

Finding the right mix: A biomaterial blend library

...de from controlled polymer blend compositions. The library currently contains scaffolds made from blends of poly(DTE carbonate) and poly(DTO carbonate). Ultimately, Becker says, the goal is to develop rapid, inexpensive methods to predict the behavior in the body of any of thousands of possible tyrosine-deri...

Gene discovery opens door to tackling disease

...ur hook and went fishing in the breast cancer gene library we came up with SLIRP, much to our surprise, as this gene had not been characterised during the mapping of the human genome," said Professor Leedman. "What's exciting is that SLIRP has the potential to shut down oestrogen in breast cancer cells and ...

FDA approves first medical device using rutgers biomaterial

...arting materials." The result in this case was a library of 112 structurally related materials created in p...mplant applications. TyRx has licensed this entire library of polyarylates from Rutgers and has now, as a first application, identified one of these polymers f...

GlycoFi announces the first production of antibodies with human glycosylation in yeast

...ral glyco-engineered yeast cell lines to produce a library of glycoforms of the anti-CD20 antibody rituximab ...next decade. GlycoFi is now working to expand its library of glyco-engineered yeast cell lines and expects to obtain a large array of specific glycoprotein va...

Mice studies illustrate potential of chimp/human antibodies to protect against smallpox

... our arsenal of medical countermeasures." Using a library of antibodies derived from the bone marrow of two vaccinia-immunized chimpanzees, the study researchers identified a pair of potent antibodies that target and neutralize the B5 protein, one of five key proteins responsible for cell-to-cell spread of ...

New RNAi tools enable systematic studies of gene function

... the construction and availability of an extensive library of molecular reagents to silence most human and mo... As described in the March 24 issue of Cell, this library consists of small RNA molecules that can switch off genes individually, allowing the user to dissect...

Free access to a digital library for developing countries

...s to Research in the Environment (OARE), a digital library for developing countries. Public and non-profit institutions in underdeveloped nations in Africa, Asia, Latin America, the Caribbean and Eastern Europe will have free access to the peer-reviewed scientific literature of Springer and other leading int...

Wild birds help to create human flu vaccine

... "Nature is the largest, incompletely catalogued library on earth," said Dr. Karesh, director of WCS's Field Veterinary Program. "This is just one more example of the value of protecting the diversity of life on our planet, and how monitoring the health of wild species serves not only to protect them, but...

Yale participates in global human genome initiative

...short, interfering ribonucleic acid sequences. The library is designed to determine when individual genes are...biology and the lead investigator for Yale. The library will be available to the Yale University research community and will be used to screen for human gen...

1 2 3

Other Tagstied 2tied 3tied 4tied 5monitoring 2monitoring 3monitoring 4monitoring 5monitoring 6monitoring 7monitoring 8monitoring 9monitoring 10neglected 2neglected 3along 2along 3along 4along 5along 6along 7along 8along 9along 10floating 2
(Date:9/5/2008)..., Evolutionary studies of aging typically ut...mice) under benign conditions constant temperatur...in the laboratory. Oddly enough, very little is kn...ressful natural environments. Could it be that the... slowly in captive luxury than do their wild cousi...
(Date:9/5/2008)... Bats, ability to echolocate may have evolved mor...week by Queen Mary, University of London scientist...te do not all group together in the evolutionary t...cholocating cousins, the fruit bats. This has rais...s evolved more than once, or whether the fruit bat...
(Date:9/4/2008)... Heidelberg, 5 September 2008 Even scientists de...ttle surprise that the media also have various way... new study appearing in the October 2008 issue of ...based on the analysis of 300 articles in British a... The Daily Mail from the UK; and Aftenposten, Dagb...
(Date:9/4/2008)... A unique partnership between Syracuse University...tter access to life-saving vaccines for children l...e world. The Institute recently awarded $250,000 ...ssistant professor of chemistry in the College of ...ainst tetanus and rotavirus, a severe form of diar...
Breaking Biology News(10 mins):Old before their time? Aging in flies under natural vs. laboratory conditions 2Molecular evolution is echoed in bat ears 2What is a gene? 2Syracuse University partners with Serum Institute of India to develop vaccines for children 2Syracuse University partners with Serum Institute of India to develop vaccines for children 3Syracuse University partners with Serum Institute of India to develop vaccines for children 4CryoCath to present at Piper Jaffray and BMO Healthcare conferences 6960 1CryoCath to present at Piper Jaffray and BMO Healthcare conferences 6960 2Masimo Corporation Given Approval to Market the Masimo Rad 57 Pulse CO Oximeter in Japan 1960 1Masimo Corporation Given Approval to Market the Masimo Rad 57 Pulse CO Oximeter in Japan 1960 2Masimo Corporation Given Approval to Market the Masimo Rad 57 Pulse CO Oximeter in Japan 1960 3Masimo Corporation Given Approval to Market the Masimo Rad 57 Pulse CO Oximeter in Japan 1960 4Amsterdam Molecular Therapeutics Initiates Program for Late Stage Liver Cirrhosis and Reports Strong Progress in AMT 011 With Trial Fully Recruited an 6952 1Amsterdam Molecular Therapeutics Initiates Program for Late Stage Liver Cirrhosis and Reports Strong Progress in AMT 011 With Trial Fully Recruited an 6952 2Amsterdam Molecular Therapeutics Initiates Program for Late Stage Liver Cirrhosis and Reports Strong Progress in AMT 011 With Trial Fully Recruited an 6952 3Amsterdam Molecular Therapeutics Initiates Program for Late Stage Liver Cirrhosis and Reports Strong Progress in AMT 011 With Trial Fully Recruited an 6952 4Canceled 3A Homecare Rally in Contra Costa County 6949 1
(Date:9/5/2008)...G, Pa., Sept. 5 /PRNewswire-USNewswire/ -- Childre...r access to comprehensive,services to protect thei...n,in grants that were announced today by the Depar...vices for children and families, the department,be...ren,s Services Planning,initiative, ICSP, in 2004....
(Date:9/5/2008)..., Md., Sept. 5 /PRNewswire-USNewswire/ -- The Heal...day announced $39 million in grants to,increase an...centers., "These grants continue President Bush,s...whose services now reach more economically,vulnera...r before," HRSA,Administrator Elizabeth M. Duke sa...
(Date:9/5/2008)...ontrolled, but you need to know what triggers them...thDay News) -- If you are one of the 36 million Am...is nowhere in the United States that is free from ... shows. , Allergies don,t only happen in the sp...ell. In the fall, the most challenging cities to l...
(Date:9/5/2008)...N, Sept. 5 /PRNewswire-USNewswire/ -- Speaker Nanc...upport of the aims of the "Stand,Up to Cancer" tel...re is not a person in our country who has not seen...s 565,000 Americans annually, and each,year there ... must work,together to make eradicating the scourg...
Breaking Medicine News(10 mins):Health News:Pennsylvania Counties Receive Grants to Improve Services for Children 2Health News:HRSA Announces $39 Million in Grants to Expand, Improve Health Center Services 2Health News:No Place Safe From Allergies 2
Other Contentsjumpingjumpingjumpingjumpingwalkwalkwalkwalkwalkwalkwalkwalkchymecircularcircularcircularcircularcircularcircularcircularcircularcirculatorycirculatorycirculatorycirculatorycirculatorycirculatorycistroncladogenesis