Navigation Links


Tag: "lessons" at biology news

Scientists seek answers on what activates deadly anthrax spores

...of California, San Diego. The research stems from lessons learned from studying the bacteria that cause Staphylococcus infections and two other bacteria in the same group as anthrax. Claiborne said the group proposes that a vitamin B5 derivative known as Coenzyme A plays a crucial role in the germination o...

Sequencing of marine bacterium will help study of cell communication

... sequenced and there is the potential for valuable lessons as it is compared with the pathogenic species. I was particularly pleased when my graduate student, Marie Faini, and I were given the opportunity to be members of the team that annotated the sequence." Annotation is a complex process that assigns fu...

Microbial forensics: The next great forensic challenge

...l microbial forensic capability. At the same time, lessons learned from the traditional forensic community for comprehensive quality assurance guidelines should be adapted to build a base of acceptance, credibility. and reliability for addressing this next grand forensic challenge." Murch will present the p...

Medical whistleblowers speak out

...count of the roundtable, in which she outlines the lessons we can learn from these whistleblowers, is published in the open access international medical journal PLoS Medicine. One of the lessons, says Lenzer, is that "ties between drug regulators and industry may influence new drug approval." Graham said at ...

Putting ecology back into river restoration

...tive process where small improvements build up and lessons are learned from any failures. The third criteria for successful river restoration is to create hydrological, geomorphological and ecological conditions that allow the river to be a resilient, self-sustaining system. The fourth criteria is to do no ...

Bees, Brains and Addiction

...sponding educational Web site with information and lessons for students, teachers and anyone else interested in neuroscience topics. Among the participants at last week's lecture were 20 students from San Diego's High Tech High, seeking to learn more about the neurobiology of drugs and addiction for their sc...

AIDS expert says global strategy needed to combat feminization of HIV/AIDS

...re women about safe-sex practices, use of condoms, lessons on negotiating safe sex, and awareness campaigns about where to seek testing and treatment. Quinn says that women are different when it comes to HIV infection, and if medical progress is to be made on how to prevent and treat the disease, then devel...

Otter adaptations: How do otters remain sleek and warm

...as been a training ground for many ecologists, and lessons learned here have been applied to the re-introduction of wolves to Yellowstone National Park.) Weisel examined wolf prey hair with light and electron microscopy with the idea of accurately identifying wolf diet from wolf scat. "While we have engaged...

Genome Sequence for Haemophilus Influenzae Completed

...as been a training ground for many ecologists, and lessons learned here have been applied to the re-introduction of wolves to Yellowstone National Park.) Weisel examined wolf prey hair with light and electron microscopy with the idea of accurately identifying wolf diet from wolf scat. "While we have engaged...

How HIV disables the cells' call for help

...study of a destructive virus may contain important lessons on how to regulate the immune system. "Perhaps," says Cohen, "we humans can adopt the virus peptide to better control overactive autoimmunity." Prof. Irun Cohen's research is supported by the Minna James Heineman Stiftung; the Robert Koch Minerva Ce...

Neurotransmitters signal aggressive cancer, offer potential for early diagnosis

...vailable to tackle metabolomics and then translate lessons learned at the laboratory bench to the patient's bedside as called for by the University's BioMed 21 initiative." BioMed 21 is a strategic research initiative that aims to rapidly translate genomic science into patient care. It includes faculty from...

Confronting Influenza: Are We Prepared?

... relevance of that structure for drug development, lessons learned from the 1918 pandemic, current H5N1 (Avian influenza) developments in Asia, the state of U.S. preparedness and influenza surveillance, and the private sector's views on drug development. ...

Researcher says flu responders can learn from 1918 epidemic

A doctoral student's research brings lessons and insight to a looming pandemic If health officials and media prognosticators are accurate, this coming winter may bring with it one of the most sweeping, deadly outbreaks of killer flu that the world has ever seen. While that prospect would terr...

Restaurant seafood prices since 1850s help plot marine harvests through history

...ng demonstrated ability to recover over time, with lessons for the recovery of such fishing grounds as the Gulf of Maine and Newfoundland, prolific until comparatively recently. Other research to be showcased at the conference describes: * How Imperial Rome developed a fish processing industry by smoki...

Russian 'surrogate' alcohols are a killer

...on," he said. "This is consistent with historical lessons which show that substance abuse is often widespread during periods of rapid transition, such as the industrial revolution." Shkolnikov concurs. "When thinking about the Russian health crisis, one should not overlook certain societal forces operatin...

Technique makes it easier to see mouse embryo in all its glory

...fects in the same mice, which teaches us important lessons about how these genes function in both cancer and development." He noted that disruption of a cancer-promoting gene, Pax 3:Fkhr, causes a bone of the nose not to form, for example. Beyond his own research into the function of cancer-causing genes,...

'Uniquely human' component of language found in gregarious birds

...ble-warble (aABb). Eleven adult birds were given lessons on distinguishing between these two sets of songs using classic reinforcement techniques. The birds were rewarded with food when they heard a song from the context-free set and for refraining when they heard one from the finite-state set. After 10,...

First demonstration of 'teaching' in non-human animals

...e done independently. Tandem followers learn their lessons so well that they often become tandem leaders and in this way time-saving information flows through the ant colony. Richardson added: "This behaviour is beautifully simple. If one experimentally removes the follower and taps the leader with a hair ...

'Dead zone' summer killed billions of ocean state mussels

...rea as big as New Jersey. Altieri and Witman said lessons from Narragansett Bay could be applied to other "dead zones." "When you lose a foundation species such as mussels ?which filter water and provide food and habitat for other organisms ?you see a large and lasting effect on the ecosystem," Witman said...

Everything in its place: Researchers identify brain cells used to categorize images

...awer, shirts in the shirt drawer, the time-honored lessons of helping organize one's clothes learned in youth. But what parts of the brain are used to encode such categories as socks, shirts or any other item, and how does such learning take place? New research from Harvard Medical School (HMS) investigat...

1 2

Other Tagstied 2tied 3tied 4tied 5monitoring 2monitoring 3monitoring 4monitoring 5monitoring 6monitoring 7monitoring 8monitoring 9monitoring 10neglected 2neglected 3along 2along 3along 4along 5along 6along 7along 8along 9along 10floating 2
(Date:9/5/2008)..., Evolutionary studies of aging typically ut...mice) under benign conditions constant temperatur...in the laboratory. Oddly enough, very little is kn...ressful natural environments. Could it be that the... slowly in captive luxury than do their wild cousi...
(Date:9/5/2008)... Bats, ability to echolocate may have evolved mor...week by Queen Mary, University of London scientist...te do not all group together in the evolutionary t...cholocating cousins, the fruit bats. This has rais...s evolved more than once, or whether the fruit bat...
(Date:9/4/2008)... Heidelberg, 5 September 2008 Even scientists de...ttle surprise that the media also have various way... new study appearing in the October 2008 issue of ...based on the analysis of 300 articles in British a... The Daily Mail from the UK; and Aftenposten, Dagb...
(Date:9/4/2008)... A unique partnership between Syracuse University...tter access to life-saving vaccines for children l...e world. The Institute recently awarded $250,000 ...ssistant professor of chemistry in the College of ...ainst tetanus and rotavirus, a severe form of diar...
Breaking Biology News(10 mins):Old before their time? Aging in flies under natural vs. laboratory conditions 2Molecular evolution is echoed in bat ears 2What is a gene? 2Syracuse University partners with Serum Institute of India to develop vaccines for children 2Syracuse University partners with Serum Institute of India to develop vaccines for children 3Syracuse University partners with Serum Institute of India to develop vaccines for children 4CryoCath to present at Piper Jaffray and BMO Healthcare conferences 6960 1CryoCath to present at Piper Jaffray and BMO Healthcare conferences 6960 2Masimo Corporation Given Approval to Market the Masimo Rad 57 Pulse CO Oximeter in Japan 1960 1Masimo Corporation Given Approval to Market the Masimo Rad 57 Pulse CO Oximeter in Japan 1960 2Masimo Corporation Given Approval to Market the Masimo Rad 57 Pulse CO Oximeter in Japan 1960 3Masimo Corporation Given Approval to Market the Masimo Rad 57 Pulse CO Oximeter in Japan 1960 4Amsterdam Molecular Therapeutics Initiates Program for Late Stage Liver Cirrhosis and Reports Strong Progress in AMT 011 With Trial Fully Recruited an 6952 1Amsterdam Molecular Therapeutics Initiates Program for Late Stage Liver Cirrhosis and Reports Strong Progress in AMT 011 With Trial Fully Recruited an 6952 2Amsterdam Molecular Therapeutics Initiates Program for Late Stage Liver Cirrhosis and Reports Strong Progress in AMT 011 With Trial Fully Recruited an 6952 3Amsterdam Molecular Therapeutics Initiates Program for Late Stage Liver Cirrhosis and Reports Strong Progress in AMT 011 With Trial Fully Recruited an 6952 4Canceled 3A Homecare Rally in Contra Costa County 6949 1
(Date:9/5/2008)...G, Pa., Sept. 5 /PRNewswire-USNewswire/ -- Childre...r access to comprehensive,services to protect thei...n,in grants that were announced today by the Depar...vices for children and families, the department,be...ren,s Services Planning,initiative, ICSP, in 2004....
(Date:9/5/2008)..., Md., Sept. 5 /PRNewswire-USNewswire/ -- The Heal...day announced $39 million in grants to,increase an...centers., "These grants continue President Bush,s...whose services now reach more economically,vulnera...r before," HRSA,Administrator Elizabeth M. Duke sa...
(Date:9/5/2008)...ontrolled, but you need to know what triggers them...thDay News) -- If you are one of the 36 million Am...is nowhere in the United States that is free from ... shows. , Allergies don,t only happen in the sp...ell. In the fall, the most challenging cities to l...
(Date:9/5/2008)...N, Sept. 5 /PRNewswire-USNewswire/ -- Speaker Nanc...upport of the aims of the "Stand,Up to Cancer" tel...re is not a person in our country who has not seen...s 565,000 Americans annually, and each,year there ... must work,together to make eradicating the scourg...
Breaking Medicine News(10 mins):Health News:Pennsylvania Counties Receive Grants to Improve Services for Children 2Health News:HRSA Announces $39 Million in Grants to Expand, Improve Health Center Services 2Health News:No Place Safe From Allergies 2
Other Contentsjumpingjumpingjumpingjumpingwalkwalkwalkwalkwalkwalkwalkwalkchymecircularcircularcircularcircularcircularcircularcircularcircularcirculatorycirculatorycirculatorycirculatorycirculatorycirculatorycistroncladogenesis