Navigation Links


Tag: "functions" at biology news

Bioartificial kidney under study at MCG

...ients by more closely mimicking the many important functions of the kidney. In ICUs today, doctors may opt for...work of the kidneys, which are involved in diverse functions ranging from regulating vitamin D to modulating the immune response. "Existing forms of dialysis hav...

A new mechanism of regulating RNA degradation

...s a well-known RNA binding protein and some of its functions in the common fruit fly Drosophila are understood. "But no one knew what Staufen1 did in human cells," said Maquat, even though its presence in mammalian cells has been recognized for several years. "We were surprised to find that Staufen1 interacts...

FDA Approves Human Hookworm Vaccine for Phase I Safety Trials

...s a well-known RNA binding protein and some of its functions in the common fruit fly Drosophila are understood. "But no one knew what Staufen1 did in human cells," said Maquat, even though its presence in mammalian cells has been recognized for several years. "We were surprised to find that Staufen1 interacts...

W.M. Keck Foundation funds study of friendly microbes

...mes and experimentally test predictions about gene functions that come from our computer-assisted analyses." G...nately, these microbes endow us with key metabolic functions that we have not had to evolve on our own," Gordon says. He and his colleagues have used mouse mode...

Plants, animals share molecular growth mechanisms

...eloped will help scientists learn more about these functions in both plants and animals. The other researchers on this study were Dipanwita Basu and Salah El-Din El-Essal, research assistants; postdoctoral students Jie Le, Chunhua Zhang and Gregore Koliantz; Eileen Malley, laboratory manager, all of the Depar...

Research on Worms Yields Clues on Aging

...inhumans, worms lived longer and retained youthful functions longer thannormal.Because the drugs affect nerve s...nuing this line ofresearch to identify the precise functions of the nervous system thatcause the worms to live longer."Because the researchers found that anticon...

Scientists seek answers on what activates deadly anthrax spores

...exploring the three-dimensional structures and the functions of the proteins involved. State-of-the-art facilities at the Center for Structural Biology will be used to determine how genetic information in the anthrax chromosome translates into a vast array of protein structures, Claiborne said. Once they know ...

Gene therapy converts dead bone graft to new, living tissue

... If calcium, which is necessary for such important functions as maintaining the brain and heart, runs low, cells called osteoclasts dig out the calcium from our bones. This is why doctors encourage post-menopausal women to take calcium supplements, so that the body doesn't raid their bones for the calcium it n...

Automatic extraction of gene/protein biological functions from biomedical text

...utomatic extraction of information related to gene functions from text has been increasing. Results: We have d...or automatically extracting the biological process functions of genes/protein/families based on Gene Ontology (GO) from text using a shallow parser and sentence ...

Essential mangrove forest threatened by cryptic ecological degradation

...lationships, lagoon fisheries, and many additional functions provided by mangroves. The authors believe that the worrying aspect of the research is that a degradation of the most vulnerable, most socio-economically important and most aesthetic species is masked by the expansion of less important species. The ...

New research questions basic tenet of neuron function

...hile activity-dependent release is responsible for functions such as learning and memory. ...

U-M scientists find genes that control growth of common skin cancer

...igan and the NationalCancer Institute examined the functions of the Hedgehog (Hh) signalingpathway in basal cell carcinoma ?the most common form of cancer ?anduncovered a subset of tumor cells that were resistant to inhibition ofthe Hedgehog pathway. The new finding has important implications forthe treatment ...

New Study from Affymetrix Laboratories Points to Changing View of How Genome Works

... two critical and exciting questions: What are the functions of these previously unannotated transcripts and what are the regulation schemes that orchestrate such complex assemblies of transcription? It seems certain that this is not the genome we learned about while in school." In the "traditional" view of t...

Highly adaptable genome in gut bacterium key to intestinal health

...ng nutrient conditions but also helps maintain the functions and stability of the gut's highly complex microbial society, according to researchers at Washington University School of Medicine in St. Louis. Their findings are reported in the March 25, 2005 issue of the journal Science. "Bacterial cells in the ...

Scientists document complex genomic events leading to the birth of new genes

...the duplicated copies of genes very quickly evolve functions that are significantly different than those of the...tional. To demonstrate that RGP-family genes have functions that are significantly divergent from those of RanBP2, Bork and his co-workers examined the subcellu...

DNA Recombination and Repair—A New Twist to RecA Function

...e and organize their activities to carry out these functions has remained obscure. Cox et al. addressed this problem in the test tube, by examining RecA filaments grown from mixing RecA protein with DNA. Previous experiments have shown that filament assembly spreads rapidly in the 5'-to-3' direction once the ...

PANTHER Protein Classification System Database 5.0

...R?system database of protein families,subfamilies, functions and pathways. Enhancements to the latestversion, P...sets ofgenes by their known or inferred biological functions and explore morethan 60 pathways associated with protein families, subfamilies, andtraining sequence...

New RNA polymerase discovered in plants

...me, or protein machine, essential for carrying out functions of cells and for expression of biological traits. ...d III perform the same distinct , though separate, functions in different species. But then along came Pol IV. Pikaard first noticed the evidence for a fourth p...

RNA project to create language for scientists worldwide

...scovery of new RNA molecules with novel biological functions is beginning to show that RNA plays far more roles than originally believed. For instance, while genomicists had previously determined that humans and chimpanzees share 99 percent of the same protein genes, it has now been discovered in the past two ...

Examination of internal 'wiring' of yeast, worm, and fly reveals conserved circuits

...l. Similar proteins involved in essential cellular functions are often similar across species. "This new result...nct "network regions" that included such essential functions as protein degradation, RNA polyadenylation and splicing, protein phosphorylation and signal transdu...

1 2 3 4 5 6 7 8 9 10

Other Tagstied 2tied 3tied 4tied 5monitoring 2monitoring 3monitoring 4monitoring 5monitoring 6monitoring 7monitoring 8monitoring 9monitoring 10neglected 2neglected 3along 2along 3along 4along 5along 6along 7along 8along 9along 10floating 2
(Date:9/5/2008)..., Evolutionary studies of aging typically ut...mice) under benign conditions constant temperatur...in the laboratory. Oddly enough, very little is kn...ressful natural environments. Could it be that the... slowly in captive luxury than do their wild cousi...
(Date:9/5/2008)... Bats, ability to echolocate may have evolved mor...week by Queen Mary, University of London scientist...te do not all group together in the evolutionary t...cholocating cousins, the fruit bats. This has rais...s evolved more than once, or whether the fruit bat...
(Date:9/4/2008)... Heidelberg, 5 September 2008 Even scientists de...ttle surprise that the media also have various way... new study appearing in the October 2008 issue of ...based on the analysis of 300 articles in British a... The Daily Mail from the UK; and Aftenposten, Dagb...
(Date:9/4/2008)... A unique partnership between Syracuse University...tter access to life-saving vaccines for children l...e world. The Institute recently awarded $250,000 ...ssistant professor of chemistry in the College of ...ainst tetanus and rotavirus, a severe form of diar...
Breaking Biology News(10 mins):Old before their time? Aging in flies under natural vs. laboratory conditions 2Molecular evolution is echoed in bat ears 2What is a gene? 2Syracuse University partners with Serum Institute of India to develop vaccines for children 2Syracuse University partners with Serum Institute of India to develop vaccines for children 3Syracuse University partners with Serum Institute of India to develop vaccines for children 4CryoCath to present at Piper Jaffray and BMO Healthcare conferences 6960 1CryoCath to present at Piper Jaffray and BMO Healthcare conferences 6960 2Masimo Corporation Given Approval to Market the Masimo Rad 57 Pulse CO Oximeter in Japan 1960 1Masimo Corporation Given Approval to Market the Masimo Rad 57 Pulse CO Oximeter in Japan 1960 2Masimo Corporation Given Approval to Market the Masimo Rad 57 Pulse CO Oximeter in Japan 1960 3Masimo Corporation Given Approval to Market the Masimo Rad 57 Pulse CO Oximeter in Japan 1960 4Amsterdam Molecular Therapeutics Initiates Program for Late Stage Liver Cirrhosis and Reports Strong Progress in AMT 011 With Trial Fully Recruited an 6952 1Amsterdam Molecular Therapeutics Initiates Program for Late Stage Liver Cirrhosis and Reports Strong Progress in AMT 011 With Trial Fully Recruited an 6952 2Amsterdam Molecular Therapeutics Initiates Program for Late Stage Liver Cirrhosis and Reports Strong Progress in AMT 011 With Trial Fully Recruited an 6952 3Amsterdam Molecular Therapeutics Initiates Program for Late Stage Liver Cirrhosis and Reports Strong Progress in AMT 011 With Trial Fully Recruited an 6952 4Canceled 3A Homecare Rally in Contra Costa County 6949 1
(Date:9/5/2008)...G, Pa., Sept. 5 /PRNewswire-USNewswire/ -- Childre...r access to comprehensive,services to protect thei...n,in grants that were announced today by the Depar...vices for children and families, the department,be...ren,s Services Planning,initiative, ICSP, in 2004....
(Date:9/5/2008)..., Md., Sept. 5 /PRNewswire-USNewswire/ -- The Heal...day announced $39 million in grants to,increase an...centers., "These grants continue President Bush,s...whose services now reach more economically,vulnera...r before," HRSA,Administrator Elizabeth M. Duke sa...
(Date:9/5/2008)...ontrolled, but you need to know what triggers them...thDay News) -- If you are one of the 36 million Am...is nowhere in the United States that is free from ... shows. , Allergies don,t only happen in the sp...ell. In the fall, the most challenging cities to l...
(Date:9/5/2008)...N, Sept. 5 /PRNewswire-USNewswire/ -- Speaker Nanc...upport of the aims of the "Stand,Up to Cancer" tel...re is not a person in our country who has not seen...s 565,000 Americans annually, and each,year there ... must work,together to make eradicating the scourg...
Breaking Medicine News(10 mins):Health News:Pennsylvania Counties Receive Grants to Improve Services for Children 2Health News:HRSA Announces $39 Million in Grants to Expand, Improve Health Center Services 2Health News:No Place Safe From Allergies 2
Other Contentsjumpingjumpingjumpingjumpingwalkwalkwalkwalkwalkwalkwalkwalkchymecircularcircularcircularcircularcircularcircularcircularcircularcirculatorycirculatorycirculatorycirculatorycirculatorycirculatorycistroncladogenesis