Navigation Links


Tag: "violent" at medical news

New Guidelines To Rehabilitate Drug Offenders

... of prison expenses, court costs, property damage, violent crimes, emergency room and other medical care, child abuse and neglect, lost child support, foster care and welfare costs, reduced workplace productivity, unemployment and the need to provide services to those victimized by drug abusers. Nora Volkow,...

Violent Students May Have Learning Disorders

...l of Pediatrics says that children who demonstrate violent behavior at schools may have underlying learning disorders// and psychiatric illnesses. Dr. Nancy Rappaport, a child psychiatrist at Cambridge Health Alliance, and colleagues from Harvard University conducted a study on 33 students in order to probe ...

Work-Related Violence Increases Risk Of Depression

...mental health problems said they were subjected to violent behavior from their work colleagues. Almost half said they had been subjected to more than one incident of violence or threatening behavior in the preceding 12 months, and one in five said they had been subjected to both. Exposure to violence b...

Violence at Work Significantly Boosts Clinical Depression Risk

...mental health problems said they were subjected to violent behaviour from their work colleagues. Almost half said they had been subjected to more than one incident of violence or threatening behaviour in the preceding 12 months, and one in five said they had been subjected to both. Exposure to violence...

Warrior Gene Claims Slammed by Maori

...edge, Turia said that it was a big leap to include violent tendencies in that. She said, "I've never felt c...his means they are going to be more aggressive and violent and more likely to get involved in risk-taking behaviour like gambling.It is controversial because i...

Mentally Challenged Boy Kept in Chains in Jharkhand

... been kept in a room tied with chains. "He becomes violent when we remove the chains - sometimes dangerous. Therefore, we have kept him in chains," the boy's elder sister told IANS. "Once Raja saw his reflection in the well and jumped into it. He was somehow saved by villagers," she adds. Raja started ...

Physical Activity Determines Academic Performance

...iting alcohol use to wearing seatbelts to avoiding violent behavior, was a list of leading health indicators that can be targeted for change. “No. 1 on the list: physical activity; No. 2: obesity,” Pivarnik said. “These are highest on the list because they are modifiable and they are related toso many di...

Male Mantids- not Voluntary Victims of Sexual Cannabilism

...at males may also have something to gain from this violent act has never been resolved experimentally. In a paper in the August issue of The American Naturalist, Jonathan Lelito and William Brown (SUNY-Fredonia), study male risk-taking behavior in a praying mantis by altering the risk of cannibalism and obse...

Scientists Coax Nerve Fibers to Regrow After Spinal Cord Injury

...g people who may face amputation of an arm after a violent injury in which nerves are wrenched from the spinal cord. The new treatment currently is under study for other types of traumatic spinal cord injury. The researchers treated experimental nerve injuries in rats with an enzyme - called sialidase - th...

Transgender Experience - A Tool to Analyze Gender Difference By Stanford Scientist

...easy to make. "It is overwhelmingly men who commit violent crimes out of rage and anger," he wrote. "If any one ever sees a women with road rage, they should write it up and send it to a medical journal." He continued, "I am tired of powerful people using their position to demean me just because I am diffe...

To Use or Not To Use Ritalin for Preschoolers

...and its side effects such as suicidal thoughts and violent behavior. Pyne in an interview to the Weekend Australian newspaper said that doctors should not prescribe Ritalin or any other ADHD medication to children which are found to be inappropriate by the drug maker. Novartis said the safety and efficacy ...

Violence Against NHS Staff On The Raise

... and figures seemingly indicate that the number of violent attacks on hospital staff in Cornwall has almost d...f are also being actively encouraged to report all violent or aggressive incidents. They explained that although the total number of incidents that have been r...

What to do with the Dead if a Flu Outbreak Happens?

... up to 207,000 Americans. Should it mimic the more violent attack 1918 strain, the death toll in the US could rise to 1.9 million. Experts have foreseen at least an 18-month period of funeral homes being short-staffed, 24-hour operations of crematories. Hospitals and morgues would quickly reach capacity. I...

Intermittent Explosive Disorder is More Prevalent Now Than Before

...zed by recurrent episodes of angry and potentially violent outbursts. This illness if left untreated may also... causing 3.5 times more property damage than other violent Intermittent Explosive Disorder subgroups. The study shows that for both broad and narrowly-define...

Violence Erupts In A Pro-quota Rally In Bihar

...na. It was reported that the protesters had turned violent during a demonstration by attacking the media persons as well as the policemen. More than 100 agitating students, armed with hockey sticks, had first started marching from Gandhi Maidan in the morning and stopped in front of Mayura Hotel raising sl...

Research into Intimate Partner Violence

...rity of abuse was rated as moderately or extremely violent in 30% to 60% of reports, depending on the type of IPV. "A picture emerges of both physical and non-physical IPV as very common, chronic, intergenerational, and present in highly overlapping forms," according to Thompson, senior investigator at Gro...

Even Hospitals Not Drug Proof

...iagnosed with bi-polar depression and suffers from violent mood swings. He is 24-year-old, with three children and has been in and out of psychiatric wards since 2001. He has attributed his present condition to his drugs use. He admits to smoking cannabis on the ward. BBC Radio's Five Live Report conducted a...

Meth Addiction On The Rise, US Health Authorities Concerned

... to unfavorable side effects such as aggressive or violent behavior (manifested at decreasing drug effect) and depression. This eventually leads to addiction, characterized by compulsive drug seeking or craving. The stimulant, which can be smoked, snorted or injected, can also induce a loss in memory and p...

Mental Hospitals Offer More Problems than Solutions

... system, of which some are docile while others are violent or sociopathic, presenting a challenge to their individual treatment. In addition the system has also been struggling with staff shortages and forced overtime. These investigative findings have shown just how far the hospitals are from meeting acce...

Certain antidepressant drugs associated with pronounced suicidal tendencies

...mon in older people. Older people tend to use more violent means, which is why they succeed more often than teenagers, who often use overdoses." Researchers analyzed 1142 suicides that took place between 1992 and 2000, primarily to ascertain whether the victims had prescribed anti depressants. The study fo...

1 2 3 4 5

Other Tagsstabilize 2stabilize 3forming 2forming 3forming 4forming 5forming 6forming 7skills 2skills 3skills 4Other Contentschloroplastschloroplastschordateschordatejumpingjumpingjumpingjumpingwalkwalkwalkwalkwalkwalkwalkwalkchymecircularcircularcircularcircularcircularcircularcircularcircular