Navigation Links


Tag: "shortens" at medical news

High Pretreatment PSA Velocity Predicts Worse Outcome

...t that other studies have found that time to death shortens as PSA velocity increases. This suggests that further research should examine using stratified PSA velocities to assess risk in men with localized disease. "These findings," conclude the authors, "highlight the ability of a pre-treatment PSA veloc...

Scientists Identify the Most Significant Single Predictor of Aggressive Prostate Cancer

...her studies that have shown that the time to death shortens as PSA velocity increases, which suggests that further research should examine using stratified PSA velocities to assess risk in men with localised disease. "These findings highlight the ability of a pre-treatment PSA velocity 2 ng/ml/year alone to...

Cancer Drug Induces HDAC Inhibitor and Enhance Long-term Memory

...genomic DNA to compress much like a telephone cord shortens as it coils. When chromatin loosens, genes associated with memory can activate more easily. Previous studies have shown that the protein CBP causes chromatin to relax, thus facilitating gene activation required for memory formation. The enzymes that ...

Surgeons Develop Simpler Way to Cure Atrial Fibrillation

... have developed and tested a device that radically shortens and simplifies a complex surgical procedure that has had the best long-term cure rate for persistent atrial fibrillation. The simplified procedure is termed Cox-maze IV, and the surgeons believe it can replace the older "cut and sew" Cox-maze III i...

Proteins in lungs of patients with cystic fibrosis

...ttacks the lungs and other organs and dramatically shortens life expectancy. The study "Comparative expression of SPLUNC1, SPLUNC2 and LPLUNC1 in normal and diseased lungs," was carried out by Lynne Bingle of the University of Sheffield School of Clinical Dentistry, Sheffield, United Kingdom, and Colin Bing...

Scientists Uncover The Secret Behind The Speed In Nerve cells Conduction

... "By halting fusion partway, complexin essentially shortens the response time for signal transmission," said Schaub, who will begin graduate school at Stanford University in the fall. "The nerve cell can almost instantaneously pass on its information." McNew said the finding is independently confirmed by wo...

Nanotechnologists Specify Limitation For Devising Small Machines

...firms the idea that the wave of a fast-moving atom shortens and lengthens depending on its distance from a surface, an idea first proposed by pioneering quantum physicists in the late 1920s. The measurement tells nanotechnologists how small they can make extremely tiny devices before a microscopic force betw...

Drooping eyelids more common in men

...id, but this can cause problems as the eyelid also shortens horizontally with age. The researchers say the next step is to study whether men suffer more frequently from lower eyelid disorders. The Dutch study also found that forehead wrinkles drag up the position of the eyebrows, the effect of which was more ...

1

Other Tagsstabilize 2stabilize 3forming 2forming 3forming 4forming 5forming 6forming 7skills 2skills 3skills 4Other Contentschloroplastschloroplastschordateschordatejumpingjumpingjumpingjumpingwalkwalkwalkwalkwalkwalkwalkwalkchymecircularcircularcircularcircularcircularcircularcircularcircular