Navigation Links


Tag: "lines" at medical news

Human Embryonic Stem Cells Could Be Later Used In Therapeutic Cloning

... researchers analyzed 14 human embryonic stem cell lines from diverse ethnic origins, derived in several different labs, and maintained for various times in culture. They tested over 1500 potential methylation sites in the DNA of these cells and in other cell types and found that the embryonic stem cells s...

Study Finds No Benefits On Self Monitoring Blood Glucose levels

...s per week. It is widely accepted that the general lines of blood glucose monitoring includes shorter diabetes duration; attending diabetes education sessions or diabetes-related clinics; seeing medical specialists; taking insulin with or without glucose-lowering oral drugs; and self-reporting episodes of ...

Tiny Sphere Of Nanoparticles Can Fight Cancer

...Mice infected with three human ovarian cancer cell lines derived from women with advanced cancer were treat...so held up in experiments with ovarian cancer cell lines resistant to docetaxel and to the chemotherapy drug cisplatin. The FAK-silencing liposome and the ...

Scientists Claim Encouraging Progress On Hereditary Diseases

...s in the development of new stem cell lines. These lines of neurons - or brain cells - could also benefit patients and could potentially be used as a reliable and renewable source of tissue for cell replacement therapy. Interesting and promising pilot research findings were presented using high dose creati...

Global avian flu database

...work to credit the scientists who are on the front lines in affected countries and also "to determine if there are ways the consortium could help facilitate benefits for those countries that are hardest hit by avian flu." “The equity issue has been discussed a lot”, she added. "We don’t have the solution...

Bird Flu Vaccine Developed in India Could be Available for 35 Paise per Dose

...collected during this year's outbreak and the cell lines taken five years ago," said Pradhan. "The vaccine can be used immediately after an outbreak to control the spread of the virus as well as for vaccination in anticipation of an outbreak. "However, vaccination before an outbreak is generally not adv...

Mummy’s place is at home, reveals surve

...rtable relationship with the children, on the same lines of a stay home mother. The survey also established that quite a chunk of the respondents felt housewives were as contented as those employed and earning. The survey also revealed the subtle yet firm demarcations of male and female jobs, similar to...

Alternative therapy – an alternative to HRT

...ate'”. She said “It deals with diet in just a few lines when there is so much to it than that. Even the Government's own National Diet and Nutrition Surveys show many of us have nutritional inadequacies that can affect brain chemistry and hormonal function. There is clearly a need for more research and fu...

The Fruit Fly to Aid in Cancer Research

...ow to compare those to similar genes in human cell lines to help him understand why some cancer cells invade and spread to other parts of the body." Derek Napier, AICR's Chief Executive says the grant awarded to Dr Baum and worth £136,000 has been given in line with the charity's policy of funding the mos...

Immune Response Linked to “Ghost” Parasites and Severely Congested Sinuss

...er from persistent inflammation of the tissue that lines the nasal and sinus cavities, according to the United States Centers for Disease Control and Prevention. Thirty-three men and women participated in the two-year study at Hopkins, designed to find out if any of the genetic traits already known to be...

Chronic Sinusitis Resulting From Weakene Immune System

...f persistent inflammation of the moist tissue that lines the nose and sinus cavities. The result is clogged passages and recurring infections, according to the U.S. Centers for Disease Control and Prevention. Because nearly one in 10 of those treated see symptoms return within weeks or months after drugs...

Stem cell trial to beat Batten Disease

...se funds are available only for study of stem cell lines derived from embryos that had been destroyed before the limit was set. Several researchers argue that in spite of the availability of some state, private and university money, including Stanford and Harvard universities, it is not enough on its own...

Curcumin –New Weapon Against Colorectal Cance

...olleagues successfully treated three melanoma cell lines with curcumin finding that treatment of curcumin induces the death of cancer cells in a dose-responsive manner. In the United States, diagnosis of colorectal cancer was made in 70,651 men and 68,883 women in 2002 and 28,471 men and 28,132 women, ac...

Nepal Plans to Promote Health Tourism Based on Traditional Medicine

...ans to step up health tourism investment along the lines of Kerala, a hot tourist destination for ayurvedic treatments and health packages. // "Being a source of rare Himalayan herbs and oils, we are looking keenly at wellness tourism," Nandini Lahe-Thapa, the Nepal Tourism Board's director of marketing ...

Antibiotic Inhibits Cancer Gene Activity

... Siomycin A must now be tested against other cell lines in the laboratory and in preliminary animal experiments before human trials could be planned. Only a tiny fraction of promising candidate drugs enter clinical trials, and few of those are ever approved. Gartel said the participation of the late Rob...

Vision restoration with a drug for macular degeneration

... revealed that they could read an additional three lines or 15 or more letters on an eye chart after a course of treatment. Lucentis (ranibizumab), is used to treat wet AMD. It has been approved for use in the U.S. but yet to be approved in Europe. The National Institute for Health and Clinical Excellen...

New wonder drug could treat blindness

...improvement" in vision, enabling them to read more lines on an eye chart than before and return to abandoned hobbies, reported the online edition of Daily mail. It is the first time a treatment for wet AMD has been found to significantly improve vision in large-scale clinical trials, said the study publi...

Williams Syndrome, the Brain, and Music

...le they can’t scribble more than a few rudimentary lines to illustrate an elephant, they can verbally describe one in almost poetic detail. “The discrepancy between their engaging social use of language and their poor visual-spatial skills is startling,” says Bellugi. “I am confident that once all the ev...

Results for Wet Age-Related Macular Degeneration Show Significant Vision Improvements

... to 40 percent experienced an improvement of three lines (15 letters) or more on the study eye chart. In th...he visual field and distortion that makes edges or lines appear wavy. The National Eye Institute estimates that there are 1.7 million people with the advan...

Clinton’s Nutrition Deal Cuts Junk Food on School Menu

...have to reformulate some products or introduce new lines of healthier snacks for children. Others will be urging schools to buy healthy, rather than cater to student cravings. Some of the items that are to be banned are fatty, extra-salty soups, calorie-ladden candy bars, and any other snack that conta...

1 2 3 4 5 6 7 8 9 10

Other Tagsprovide 2provide 3provide 4provide 5provide 6provide 7provide 8provide 9provide 10clothes 2clothes 3clothes 4fortified 2fortified 3fortified 4limitation 2asks 2asks 3asks 4diuretics 2medicine 2medicine 3medicine 4medicine 5medicine 6medicine 7medicine 8medicine 9medicine 10journal 2journal 3journal 4journal 5journal 6journal 7journal 8journal 9journal 10highlighted 2leukemia 2leukemia 3leukemia 4adult 2adult 3adult 4adult 5adult 6adult 7adult 8adult 9adult 10
(Date:1/9/2009)..., "Widespread and Profound Opposition" Cited , .../ -- In response to letters, petitions and other r...ties and worksites across California, the Executiv...W), consistent with provisions contained in the Se...Constitution, has sent a letter today to SEIU Pres...
(Date:1/9/2009)...Death rates and complications plummet for immunize.... 9 (HealthDay News) -- If you,re over 65, getting...g from flu in half, research suggests. , And, e...r the strains circulating in any given year, a rec...ncluded 10 flu seasons, worth of data also found t...
(Date:1/9/2009)..., Calls on Obama and Biden to Develop Alternativ...USNewswire/ -- A new report concludes that so-call... trafficking in persons and in fact can be counter...s Project at the Urban Justice Center, released ju...ng Awareness on January 11, summarizes findings fr...
(Date:1/9/2009)..., Report will focus on major trends and growth p...RNewswire/ -- Gerson Lehrman Group, the world,s ma...Technology Association (AdvaMed) today announced a...-edge industry experts on the major trends and gro...ts kind survey aims to generate new data points on...
Breaking Medicine News(10 mins):Health News:UHW Members Call on SEIU to Schedule Disaffiliation Vote 2Health News:You're Never Too Old for a Flu Shot 2Health News:You're Never Too Old for a Flu Shot 3Health News:Report Finds That Raids Are Not an Effective Tool Against Human Trafficking 2Health News:Report Finds That Raids Are Not an Effective Tool Against Human Trafficking 3Health News:Report Finds That Raids Are Not an Effective Tool Against Human Trafficking 4Health News:Gerson Lehrman Group Partners With AdvaMed for Survey on Medical Device Industry 2Health News:Gerson Lehrman Group Partners With AdvaMed for Survey on Medical Device Industry 3
(Date:1/8/2009)...The evolutionary history of diatoms -- abundant oc...bon dioxide from the air each year -- needs to be ...indings suggest that after a sudden rise in specie...ion years ago -- trends that coincided with severe...Jan. 8 issue of the journal Nature . , The resea...
(Date:1/8/2009)... drought and flood come in rapid succession, the e...n the sequence of those events, according to a new... The study, which focused on tree species common ... maintained higher growth rates and were less like...od, rather than vice versa. The findings could hav...
(Date:1/8/2009)... is an international journal that publishes origi...ical and molecular aspects of entomology, plant pa...ncluding insecticides, fungicides, herbicides and ...the control of pests and diseases. , Phytoparas...tes and book reviews. Guest editorials written by...
(Date:1/7/2009)...rginia, January 7 WCC Smart Search...mance search and match software, today,announced ...ce President of,Sales for the ID market. , ...cs and ID management,industry. He was most recent...as responsible for strategic product development, ...
Breaking Biology News(10 mins):Decline of carbon-dioxide-gobbling plankton coincided with ancient global cooling 2Sequence matters in droughts and floods 2Springer expands its portfolio in plant sciences with Phytoparasitica 2Supelco 28R 29 Expands Ascentis 28R 29 Express HPLC Columns Line for High Speed and High Efficiency Separations 7467 1Supelco 28R 29 Expands Ascentis 28R 29 Express HPLC Columns Line for High Speed and High Efficiency Separations 7467 2New nano device detects immune system cell signaling 26053 1New nano device detects immune system cell signaling 26053 2New nano device detects immune system cell signaling 26053 3New nano device detects immune system cell signaling 26053 4New nano device detects immune system cell signaling 26053 5Feinstein Institute 3A Researching a Family Tree of Autoimmune Disorders 26052 1Feinstein Institute 3A Researching a Family Tree of Autoimmune Disorders 26052 2Feinstein Institute 3A Researching a Family Tree of Autoimmune Disorders 26052 3Feinstein Institute 3A Researching a Family Tree of Autoimmune Disorders 26052 4Feinstein Institute 3A Researching a Family Tree of Autoimmune Disorders 26052 5Teva and Barr Receive FTC Request for Additional Information 26048 1Teva and Barr Receive FTC Request for Additional Information 26048 2Teva and Barr Receive FTC Request for Additional Information 26048 3Teva and Barr Receive FTC Request for Additional Information 26048 4Teva and Barr Receive FTC Request for Additional Information 26048 5
Other Contentsjumpingjumpingjumpingjumpingwalkwalkwalkwalkwalkwalkwalkwalkchymecircularcircularcircularcircularcircularcircularcircularcircularcirculatorycirculatorycirculatorycirculatorycirculatorycirculatorycistroncladogenesis