Navigation LinksBiology NewsHealth NewsBiology TechnologyMedicine Technology


We're sorry, that page (http://www.bio-medicine.org/tag-1/lin/) was not found.

Search tag 1 lin at Google

Search tag 1 lin at Yahoo

Search tag 1 lin at Bing

Google
 
(Date:4/17/2017)... Florida , April 17, 2017 NXT-ID, ... technology company, announces the filing of its 2016 Annual Report on ... and Exchange Commission. ... on Form 10-K is available in the Investor Relations section of ... as on the SEC,s website at http://www.sec.gov . ...
(Date:4/11/2017)... GARDENS, Fla. , April 11, 2017 /PRNewswire/ ... management and secure authentication solutions, today announced that ... by Intelligence Advanced Research Projects Activity (IARPA) to ... IARPA,s Thor program. "Innovation has been ... and IARPA,s Thor program will allow us to ...
(Date:4/11/2017)... -- NXT-ID, Inc. (NASDAQ:   NXTD ) ("NXT-ID" ... of independent Directors Mr. Robin D. Richards and ... furthering the company,s corporate governance and expertise. ... Gino Pereira , Chief Executive Officer ... guidance and benefiting from their considerable expertise as we move ...
Breaking Biology News(10 mins):
(Date:9/25/2017)... ... 2017 , ... Winners in the 2017 Stevie® Awards ... during a gala event in New York City. The awards recognize the world’s ... suppliers who help to create and drive great places to work.     , A ...
(Date:9/25/2017)... ... September 25, 2017 , ... ... solutions for drugs, biologics and consumer health products, today announced that two of ... validation of bioassays at two upcoming conferences. , At the BEBPA 10th Annual ...
(Date:9/25/2017)... ... September 25, 2017 , ... ... Portable, Continuous, Miniature, and Modular (PCMM) collaboration with Pfizer and GEA by designing ... Dosage line. The new PODs will provide tablet coating capability in the existing ...
(Date:9/25/2017)... PITTSBURGH, PA (PRWEB) , ... September 25, 2017 , ... ... efficient way to update patient charts in hospitals and medical facilities, so he invented ... to access and update patient charts. In doing so, it offers an improved alternative ...
(Date:9/25/2017)... ... , ... Lean Management techniques applied to the laboratory have ... laboratory weighing is designed to help laboratory personnel strengthen lab processes and ... downstream processes. , If a problem is detected, the "First-Defect-Stop" procedure should be ...
Breaking Medicine News(10 mins):
Mouse monoclonal antibody raised against a full length recombinant SLC25A11. NCBI Entrez Gene ID = SLC25A11...
Mouse polyclonal antibody raised against a partial recombinant SYT4. NCBI Entrez Gene ID = 6860...
Agarose II (Low Melt)...
... Mouse polyclonal antibody raised against a partial ... FES (AAH35357, 120 a.a. ~ 250 a.a) ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products:
... of single-use instruments on the market., Available in ... Bariatric Surgery. , Dual action tips provide ... pivot points to reduce the chance of alternative ... which eliminates gapping at connection and the need ...
SOLOS Endoscopy shares your commitment to provide every patient with the highest quality care available through our ongoing research and development of advanced surgical instruments and diagnostic so...
Operate with confidence. Autosuture is advancing the sate of both open and minimally invasive surgery by providing surgical tools that feel right, function right, and facilitate the right outcome eve...
Operate with confidence. Autosuture is advancing the sate of both open and minimally invasive surgery by providing surgical tools that feel right, function right, and facilitate the right outcome eve...
Medicine Products:
(Date:9/21/2017)... UK (PRWEB) , ... September 21, 2017 , ... ... a QuintilesIMS company, who enable the world’s most progressive pharma and biotech organizations ... clinical trials at top pharma and biotech events in Q4. , DrugDev will ...
(Date:9/21/2017)... ... 2017 , ... Lajollacooks4u welcomed the San Diego chapter of Les Dames d’Escoffier ... professional women with high achievement in the fields of food, fine beverage and hospitality, ... members began with an olive oil tasting to whet their palettes and then rolled ...
(Date:9/20/2017)... (PRWEB) , ... September 20, 2017 , ... ... today that it has appointed Vishwas Paralkar to the role of chief scientific ... targeting technology. He will report to Cybrexa’s president and CEO, Per Hellsund. , ...
(Date:9/20/2017)... ... 20, 2017 , ... Proscia Inc. , a data ... of whole slide imaging solutions, are hosting a pre-conference workshop at the ... a Best-in-Class Strategy for Digital Pathology,” will feature Proscia CEO, David West Jr., ...
Breaking Biology Technology:
(Date:9/6/2017)... , Sept. 6, 2017  Medical professionals ... and skills while treating their patients. Medical ... experience without involving patients. Simulation provides a ... can carry out procedures, refine techniques and ... Integration of new technology, such as augmented ...
(Date:9/5/2017)... 5, 2017  Xyntek Inc. has announced another milestone in their continued growth ... to meet the growing demands of customer engagements regionally.  ... Xyntek's new Midwest office is located at 318 West Adams Street, Suite ... Xyntek's ... ...
(Date:9/1/2017)... 2017  Explorers Like Us ( https://explorerslikeus.com/ ) is embarking ... — and deliver these experiences as part of Life Environments™, ... and heal better. ... While nothing beats a walk, jog or simply playing ... Environments™ is the next best thing when getting there isn’t ...
Breaking Medicine Technology: