Navigation Links


Tag: "happen" at medical news

Puppet Show, Music Gives Message - 'say No to Drugs'

...the human spirit. "Recovery is a process, it can't happen in a day. But the challenge is not to give up just like Tushar Sampad. "Every year there is a theme to mark this day. This year it is 'do drugs control your life?' And the answer is 'my life, my community, no place for drugs'," Kumar said. She ad...

'Missing Link' Stem Cells may Shorten Path to Therapies

...l -- a profound understanding of what makes things happen in the early development of embryonic stem cells."...

Probiotic Drinks can Stave Off Hospital Infection

... usually caused by antibiotics, most cases usually happen in a healthcare environment such as a hospital or care home. Older people are most at risk from infection, with the majority of cases (80%) occurring in people over the age of 65. The number of C. diff cases has risen from 22,000 a year in 2002 to ...

Canadian Mountain Bikers Hit by Bacterial Infection

...drank. They want to find out the cause so it won't happen again, Galanis said. "It's a very uncomfortable infection," she said. "Things just fly through you basically." People usually get sick within the first 10 days of exposure, she said, and it is rarely spread from person to person. "We think that...

Australian Grape Glut Dries Up as Drought Bites

...s are going to need more water. "What's going to happen in time is that vines are going to have to go further up the hill." Dolle believes Orange's cool climate, soil and altitude make it a good place to produce wines, particularly whites. "If there is a lack of water around Australia and an abundance...

Interview With a Surgeon Hidden Hero of the NHS

...ards of practice an effective re-certification can happen only when it is designed specifically for Indian conditions. Simply setting up re-certification for the sake of it or copying some other countrys model will only be seen as another hurdle by doctors and may not serve the desired effect of maintaining...

Hoarding can Endanger Lives, Says New Study

...away. For treatment to be successful, it must also happen where the patients hoard. "It is important that they receive some sort of therapeutic help in the home. It is usually the best strategy for the therapist to train family or friends or volunteers how to help," Hart said....

Hearts Saved As Doctors Put Cutting Edge Discoveries to Use

... the results are "exactly what we would hope would happen from the major efforts in this area over the past decade. Yet, the tragedy is that too many patients delay before coming to the hospital," Smith added....

Useful Parasites

...g the infected host. We just didn't expect it to happen so quickly," Weeks told LiveScience. It is yet to be seen how the parasite activates such fertility. Weeks is speculating on the fact that maybe, it produces some nutritional benefit in the host. Remarkable evolutionary changes usually millions of ...

Doctors Warned Against Encouraging Elective Caesareans

...need to be informed of the possible risks that can happen throughout the pregnancy and how it is important to have their scheduled ultrasound scans to detect if the baby is developing safely. 'Should a woman encounter unusual bleeding during her pregnancy, it is best if she sees the doctor immediately', ...

Capricious Climate in Indonesia Adds to Farmers Woe

...rom local officials is that a flood like this will happen every five years. I don't understand climate chang...anners and the people who can actually make things happen in this nation....

Placental Problems in Women Linked With Caesarean Section

...need to be informed of the possible risks that can happen throughout the pregnancy and it is important to have their scheduled ultrasound scans to detect if the baby is developing safely. Should a woman encounter unusual bleeding during her pregnancy, it is best if she sees the doctor immediately....

When Smell Cells Fail They Call In Stem Cell Reserves

...nstant assault from harsh chemicals that one might happen to catch a whiff of by accident, risking damage or death. To figure out how the olfactory system repairs severely damaged nerve cells, Reeds team exposed mouse olfactory nerves to a cloud of toxic methyl-bromide gas. Methyl bromide kills not only o...

FDA Advises Manufacturers to Test Glycerin for Possible Contamination

...lace controls to ensure that this problem does not happen in the U.S. or elsewhere. The most recent incident occurred in Panama in September 2006 and involved DEG-contaminated glycerin used in cough syrup, which resulted in dozens of hospitalizations for serious injury and more than 40 deaths. In late 1...

Many Senior Citizens in the Grips of Malnutrition

...he tip of the iceberg. Malnourishment doesn't just happen out of the blue. I'd suggest that in these individuals, it's been going on for several years. Elderly patients may appear to be a healthy weight but in fact be malnourished so body mass index alone is a poor indicator.' Associate Professor Bolin we...

Operation on Pillow Angel Violated Laws, Says US Advocacy Group

...re that sterilization of disabled children doesn't happen again without a court order, it will seek court approval for other procedures involved in the controversial growth attenuation therapy. "We deeply regret that a court order was not obtained," Dr. David Fisher, medical director at Children's Hospita...

Health Authorities Fear West Nile Season Again in US

...erally believed that the spread of the disease may happen late. The West Nile virus transmits between mosquitoes and birds. Infected mosquitoes transmit the virus to birds, animals and also to humans.A well known entomologist claims that mosquitoes haven't been able to reproduce as prolifically as in prev...

Mother's Day Surprise

...d left behind some chocolates and a perfume, which happen to be my mothers favorite, to be delivered to her on Mothers day informs Parakh. No just this; on Sunday starting at 12 PM in the night, Parakh will be getting bouquets of flowers delivered to her mother. The first would be at mid-night, the second...

US Professors Develop Fusion Protein to Fight Cancer

...proteins or peptides together. Fusion proteins can happen naturally or it can be created artificially in a laboratory for research purposes. The newly developed protein by Thomas Pento and Roger Harrison can keep some types of cancer cells from ingesting a vital protein called methionine that doesn't affe...

Tony Abbott Confident Of Australias Vote For Performance Not Promise

...ott was quoted. But I don't think that's likely to happen with the current shadow." He braced his statements noting that Ms Roxon did not ask many questions relating to health during parliamentary question time. "All the things they (Labor) have criticized the government for, the government has actually...

1 2 3 4 5 6 7 8 9 10

Other Tagsrhesus 2nature 2nature 3nature 4nature 5nature 6nature 7nature 8nature 9nature 10
(Date:11/25/2009)...ire-USNewswire/--WhenmostpeopleheartheacronymTMJ,t...patientsthehelptheyneed.TMJstandsfortheTemporal-Ma...s/connectswithyourskull(temporalbone). ,, Themo...nwithchewing,clickingorpoppingofthejaw.Butmanyothe...adaches,fatigue,sleepdisturbances,irritability,alo...
(Date:11/25/2009)...-SentinelleMedicalInc.,aleadingmanufacturerofbreas...suiteofnewleadingedgeclinicalapplicationsonitsAegi...iologicalSocietyofNorthAmerica(RSNA)annualmeetingi...licationsleveragetheuniquehighqualityimagesgenerat...rtmultipleimagingmodalitiesformulti-parametricasse...
(Date:11/25/2009)...wire/--TheBayAreaAirQualityManagementDistrictisiss... Alert forThursday,November26,2009whichbansbu...bothindoorsandoutdoors. ,, "Cold,stillweatherwi...kBroadbent,executiveofficeroftheAirDistrict."We,re...ghborsandfellowcommunitymembersthisThanksgiving,an...
(Date:11/25/2009)...ew out of a collaboration between UCLA engineers a...nearly 10 million Americans who suffer from periph...ning of the arteries, peripheral arterial disease,...narrowed arteries reduce blood flow to the limbs. ...r disease, heart attack and stroke, and its progre...
(Date:11/25/2009)...on and treatment clinics to resume Monday, Nov. 30...mber 25, 2009 -- Centegra Health System is continu...shots at four Centegra Primary Care (CPC) vaccinat...arrived. The clinics are at CPC sites in Huntley, ...en as follows: ,   From 4:30 to 7:30 p...
Breaking Medicine News(10 mins):Health News:Sentinelle Medical Launches Aegis Suite of Oncology 4D Visualization Software with PureWeb(TM) Technology 2Health News:Sentinelle Medical Launches Aegis Suite of Oncology 4D Visualization Software with PureWeb(TM) Technology 3Health News:Winter Spare the Air Alert in Effect for Thursday, November 26, 2009 2Health News:Engineers, doctors at UCLA develop novel material that could help fight arterial disease 2Health News:Engineers, doctors at UCLA develop novel material that could help fight arterial disease 3Health News:Engineers, doctors at UCLA develop novel material that could help fight arterial disease 4Health News:Centegra H1N1 Vaccination Clinics to Resume Tuesday, Dec. 1 2Health News:Centegra H1N1 Vaccination Clinics to Resume Tuesday, Dec. 1 3Health News:Centegra H1N1 Vaccination Clinics to Resume Tuesday, Dec. 1 4
(Date:11/24/2009)...ystallised a protein that may help gut bacteria bi...d be used by probiotic producers to identify strai.... , "Probiotics need to interact with cells linin... attach to surfaces in the gut they are more likel...ity," says Dr Nathalie Juge from the Institute of ...
(Date:11/24/2009)...W YORK (November 24, 2009) -- The Wildlife Conserv...ling that the last remaining population of Siberia...the rising tide of poaching and habitat loss. , ...ussian officials of what needs to be done to prote...t. , The report was released by the...
(Date:11/24/2009)...vailable in Spanish . , The presence of inc...flammatory substances in the blood, hinders the lo...esearch project of the University of Navarra condu...he School of Pharmacy. , The project, entitled "...to the control of body weight and inflammation," e...
Breaking Biology News(10 mins):A sticky solution for identifying effective probiotics 2Report shows dramatic decline in Siberian tigers 2It can be predicted the reaction obese patients will have to a diet 2Enzyme doesnt act alone in atrial fibrillation 8877 1Enzyme doesnt act alone in atrial fibrillation 8877 2The bitter side of sweeteners 8874 1The bitter side of sweeteners 8874 2BenefitMall Hosts New World of Healthcare Forum to Empower Partners to Find Solutions for Volatile Healthcare Industry 49218 1BenefitMall Hosts New World of Healthcare Forum to Empower Partners to Find Solutions for Volatile Healthcare Industry 49218 2BenefitMall Hosts New World of Healthcare Forum to Empower Partners to Find Solutions for Volatile Healthcare Industry 49218 3
Other Contentsmicrocephalymidwifemidwifeheadachesheadachesheadachesheadachesheadachesmigrainesmigrainesmigrainesmilia