Navigation LinksBiology NewsHealth NewsBiology TechnologyMedicine Technology


We're sorry, that page (http://www.bio-medicine.org/tag-1/eye/) was not found.

Search tag 1 eye at Google

Search tag 1 eye at Yahoo

Search tag 1 eye at Bing

Google
 
(Date:3/30/2017)... HONG KONG , March 30, 2017 ... developed a system for three-dimensional (3D) fingerprint identification by adopting ground ... technology into a new realm of speed and accuracy for use ... applications at an affordable cost. ... ...
(Date:3/29/2017)... March 29, 2017  higi, the health IT company ... North America , today announced a Series ... acquisition of EveryMove. The new investment and acquisition accelerates ... tools to transform population health activities through the collection ... higi collects and secures data today on ...
(Date:3/27/2017)... 2017  Catholic Health Services (CHS) has been ... (HIMSS) Analytics for achieving Stage 6 on the ... In addition, CHS previously earned a place in ... electronic medical record (EMR). "HIMSS Analytics ... EMR usage in an outpatient setting.  This recognition ...
Breaking Biology News(10 mins):
(Date:10/13/2017)... ... October 13, 2017 , ... While it’s often important to take ... an inventor from Austin, Texas, has identified a solution. , She developed a prototype ... restricted lighting. As such, it eliminates the need to turn on a light when ...
(Date:10/13/2017)... ... ... Lori R. Somekh, founder of the Law Office of Somekh & Associates ... special needs planning attorneys. “Membership in ElderCounsel helps our office remain up to date ... elder law attorneys nationwide,” said Somekh. , ElderCounsel was founded by ...
(Date:10/13/2017)... ... ... Global Healthcare Management’s 4th Annual Kids Fun Run brought out many kids this ... by Global Healthcare Management’s CEO, Jon Letko, is aimed at getting kids excited about ... ages; it is a non-competitive, non-timed event, which is all about having fun and ...
(Date:10/13/2017)... ... October 13, 2017 , ... “America On The Brink”: the ... “America On The Brink” is the creation of published author, William Nowers. Captain ... As a WWII veteran, he spent thirty years in the Navy. Following his ...
(Date:10/12/2017)... (PRWEB) , ... October 12, 2017 , ... IsoComforter, Inc. ... products, announced today the introduction of an innovative new design of the shoulder pad. ... so you get maximum comfort while controlling your pain while using cold therapy. By ...
Breaking Medicine News(10 mins):
... Lines ,High Quality, Functionally-Validated, Ion Channel Cell ... for having a critical role in nerve ... key function in pain, CNS and the ... been investigated in therapeutic areas, such as ...
Mouse monoclonal antibody raised against a partial recombinant CHD8. NCBI Entrez Gene ID = CHD8...
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
... Mouse monoclonal antibody raised against a partial recombinant ... 56 a.a. ~ 145 a.a) partial recombinant protein ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Biology Products:
... it the "Super 90". Volk's SuperField® has ... diagnosis for today's discriminating practitioner. Its ideal ... make it perfect as the primary high ... SuperField has been specifically designed for increased ...
... The Double Aspheric 78D is an ... lens offering an ideal .93x image ... of view. It is optimally designed ... motion of all slit lamps. Available ...
The Volk 30D is designed to provide the practitioner a wide field of view with a short working distance. This lens is excellent for use with small pupils....
The Pan Retinal® 2.2 uniquely combines magnification nearly that of the 20D lens with a field of view approaching that of the 30D lens. Excellent for virtually every examination procedure, includ...
Medicine Products:
(Date:10/11/2017)... (PRWEB) , ... October 11, 2017 , ... ... pathology, announced today it will be hosting a Webinar titled, “Pathology is going ... Pathology Associates , on digital pathology adoption best practices and how Proscia improves ...
(Date:10/11/2017)... ... 11, 2017 , ... Singh Biotechnology today announced that the ... its novel anti-STAT3 (Signal Transducer and Activator of Transcription 3) B VHH13 single ... the cell membrane and bind intracellular STAT3 and inhibit its function. Dysregulation of ...
(Date:10/10/2017)... , Oct. 10, 2017 International research firm Parks Associates ... will speak at the TMA 2017 Annual Meeting , October 11 ... in the residential home security market and how smart safety and security ... Parks Associates: ... "The residential security ...
(Date:10/9/2017)... ... October 09, 2017 , ... The award-winning American Farmer television series will ... American Farmer airs Tuesdays at 8:30aET on RFD-TV. , With global population estimates ... of how to continue to feed a growing nation. At the same time, many ...
Breaking Biology Technology:
(Date:9/19/2017)... , Sept. 19, 2017 HistoSonics, Inc., a venture-backed medical device company developing ... of targeted tissues, announced three leadership team developments today:   ... ... ... Veteran medical device executive Josh Stopek ...
(Date:9/18/2017)... KALAMAZOO, Mich. , Sept. 18, 2017 ... , and OptiMed Specialty Pharmacy of Kalamazoo, ... offer a strategic hub service that expedites and streamlines ... personal spirometer, Spiro PD 2.0, and wellness management services.  ... is a medical device used to measure lung function ...
(Date:9/13/2017)... ATLANTA , Sept. 13, 2017   OrthoAtlanta ... to the Atlanta Football Host Committee (AFHC) for the 2018 ... Monday, Jan. 8, 2018, at Mercedes-Benz Stadium in ... part of the AFHC "I,m In" campaign, participating in many ... ...
Breaking Medicine Technology: