Navigation Links


Tag: "declined" at medical news

Madhya Pradesh Gets Tough on Sex Determination Tests

... girls per 1,000 boys in the state in 1981, it has declined to 932 girls as per Census 2001," he said. The 2001 Census figures paint a startling picture about the gender balance in some districts with the worst affected being Bhind (832 girls per 1,000 boys), Morena (837) and Gwalior (853). In some villages...

Indonesia Has Stopped Sharing Vital Bird Flu Data

...hts of the deadly strain of the virus. However, he declined to give further details. Baxter confirmed late Monday that it expected to conclude a "framework for future collaboration" with Indonesia this week, which could involve intellectual property issues, but stressed that it would continue to comply wi...

Drug Strategy Makes Cancer Genes Get Lost in Translation

...ile expression of two oncogenes, c-Myc and Bcl-xL, declined significantly. "Our results demonstrate that it is possible to inhibit the protein-protein interaction between eIF4E and eIF4G using small molecules and to establish a methodology that can readily be used to identify new classes of such inhibitors...

Ranbaxy in Fray to Buy Merck's Generic Drugs Unit

...ion was expected to start next month. He, however, declined to give any financial details. ‘Merck makes sense for us since it would result in a major gain for us in the global generics business and a strategic fit for our activities,’ Singh said, adding: ‘I have been talking to some private equity funds eve...

Seoul Lab Clones Poodle

...kthrough in animal cloning,'' said the source, who declined to be named. The cloning seems to demonstrate the team's unparalleled technologies on dog cloning, something no other scientists have yet to succeed in,'' the source said. He refused to specify further. His remarks came after Science and Techno...

Obesity Surgeries Have Jumped Dramatically Since 1998

...te for patients hospitalized for bariatric surgery declined 78 percent, from 0.9 percent in 1998 to 0.2 percent in 2004. Certain procedures, known collectively as bariatric surgery, have been proven beneficial in obese persons who have tried and failed to lose excess weight by diet, exercise, and other mean...

Severe Cold is Harbinger of Infections

...ial of the Indian Council of Medical Research, who declined to be named. The virus infections tend to infect children between one-and-a-half to five years age, said Sisir Paul, a paediatrician with Max Super Speciality Hospital, Saket, in south Delhi. "In this cold weather we have seen a 25 percent rise i...

Carriers With Alzheimer's High Risk Gene Type Age Normally Until the Disease Strikes

...ading vocabulary, which tends to hold up with age) declined across age groups, a sign of normal cognitive aging. However, APOE4 did not affect performance at any age. Thus the researchers conclude that at least between ages 20 and 64, people with APOE4 age normally in those central cognitive functions. This...

Fresh Polio Case Reported in Jammu

...d a top official of the National Polio Project who declined to be named. "The recent surge in the cases in north India is a cause of worry. The first case from Jammu is a clear indication that the polio strain is constantly covering new grounds," the official told IANS. He said since both Pakistan and Ind...

All Foreign-born Nationals In US To Be Tested For TB

...f annual cases of TB reported in US-born residents declined by 93% from 1993 to 2004, while those among foreign-born cases increased by 5%. PRI...

Anthrax Attack - Greater Potential Threat Than Thought

...e induced both. Finally, cellular immune responses declined with post-exposure use of antibiotics, suggesting that the intervention impeded spore germination and implying that it may reduce the incidence of both subclinical and clinical B. anthracis infection. In an accompanying editorial, James L. Hadler, ...

Declined Folate Levels in US Young Women

... of folate in young women of childbearing age have declined since the late 1990s, despite public health efforts//, which is a disturbing development that may increase birth defects. The study is being published this week in a CDC publication, Morbidity and Mortality Weekly Report. Though the health offic...

TB can Be Eradicated in the U.S With Modified Guidelines: Study

...f annual cases of TB reported in U.S.-born persons declined by 93 percent from 1993 to 2004, while foreign-born cases increased by five-percent. "For example, in 2004, a total of 14,517 cases of TB were reported," said Dr. Cain. "Of these, 3,444 or 24 percent were foreign-born persons who had entered the Un...

Clues Found On How Deadly Bacterium Gains Foothold

...emia or 'rabbit fever' infection has significantly declined since the 1940s. However, the bacteria would be very deadly as an aerosolized terrorist weapon -- inhaling as few as 10 bacteria could be potentially deadly," said Allen, who also is a staff researcher with the Veterans Affairs Iowa City Health Care ...

Estrogen Study Provides New Hope For Colon Cancer Treatment

...h as hot flashes and bone loss, but the number has declined considerably since 2002. That year, investigators reported that, for many women, the supplements carried more health risks than benefits.The research by Chan and her colleagues drew on data from 834 postmenopausal women enrolled in the Nurses' Health...

Contraceptive Use Helps Reduce Rate of US Teen Pregnancy

... Between 1995 and 2002, U.S. teen pregnancy rates declined by almost one-quarter (24%). The new study examines the data to determine the relative contributions of abstinence and contraceptive use to this decline. According to the analysis, most of the decline (86%) was due to more se xually active teens usin...

A Snapshot of the Findings of the National Family Health Survey in India

...nt, ORC Macro said, "Child marriage, for instance, declined drastically from the first to the third survey. It’s very rare, nationally." The percentage of married women who are subject to spousal violence ranged from 25 per cent in Punjab to 39 per cent in Orissa. The data enabled by this survey establishe...

Disability Factor Among Older Americans Shows Improvement

...evere disability among the older lot, 65 and above declined from 26.5 percent in 1982 to 19 percent in 2004/2005. The study was funded by the National Institute on Aging (NIA), a component of the National Institutes of Health (NIH). A caregiving component of the survey was supported by the Office of the Ass...

Tobacco Companies Admit Their Products Cause Cancer but Not in Those Who Sue Them

...oof to link cigarette smoking with cancer' defence declined as companies began to publicly admit that smoking causes disease, starting in the late 1990s. But the defence of mitigating factors and the exercise of free will correspondingly increased over the same period. The authors conclude: The cigarette...

WHO Attributes Death of Millions in Africa to Treatable diseases

...most completely eradicated and measles deaths have declined more than 50 percent since 1999. NLA...

1 2 3 4 5 6 7 8 9 10

Other Tagsrhesus 2nature 2nature 3nature 4nature 5nature 6nature 7nature 8nature 9nature 10
(Date:11/25/2009)....25/PRNewswire/-SentinelleMedicalInc.,aleadingmanu...ftwarelaunchesasuiteofnewleadingedgeclinicalapplic...atthisyear,sRadiologicalSocietyofNorthAmerica(RSNA...0,HallA).Theapplicationsleveragetheuniquehighquali...ngcoilsandsupportmultipleimagingmodalitiesformulti...
(Date:11/25/2009)...icalEndorsements,Business,andPressJoinEfforttoEduc...ire/--Onceagain,theNationalBipolarFoundationandthe...heir"Safe,tilStable"program,whichisnowbeingwidelya...order.Today,theNationalBipolarFoundationreceivedap...ailfromtheLt.GovernorofLouisianaMitchLandrieu.TheN...
(Date:11/25/2009)... period was too short to draw definite conclusions...HealthDay News) -- In diabetic patients with block...rence in outcomes at one year whether patients und...British researchers report. , Bypass surgery ha...s with coronary artery disease. However, less inva...
(Date:11/25/2009)...te, CDC sees few signs of trouble with the H1N1 va...y News) -- The ongoing H1N1 swine flu pandemic may... among younger patients, a U.S. health official sa...erious pneumococcal infections around the country,...er for Immunization and Respiratory Diseases at th...
(Date:11/25/2009)...eat colorectal cancer also can reverse a rare stom...herapy for the disease, researchers at Vanderbilt ...rier,s disease causes thickening of the stomach li...as well as anemia and swelling in the feet and ank... risk for gastric cancer. Previously, the only eff...
Breaking Medicine News(10 mins):Health News:Sentinelle Medical Launches Aegis Suite of Oncology 4D Visualization Software with PureWeb(TM) Technology 2Health News:Sentinelle Medical Launches Aegis Suite of Oncology 4D Visualization Software with PureWeb(TM) Technology 3Health News:First Time-Door is Open for Family Discussion of Bipolar Disorder 2Health News:First Time-Door is Open for Family Discussion of Bipolar Disorder 3Health News:Stenting May Equal Bypass for Diabetic Heart Patients 2Health News:Stenting May Equal Bypass for Diabetic Heart Patients 3Health News:Swine Flu Tied to Rise in Pneumonias Among Young 2Health News:Swine Flu Tied to Rise in Pneumonias Among Young 3Health News:Swine Flu Tied to Rise in Pneumonias Among Young 4Health News:Vanderbilt scientists report first effective medical therapy for rare stomach disorder 2
(Date:11/24/2009)...el action of a remarkable class of ring-shaped pro... the Lawrence Berkeley National Laboratory (Berkel...graphy beamline at the Advanced Light Source (ALS)...expression and replication, and are vital to the s...ious agents, such as the human papillomavirus, whi...
(Date:11/24/2009)... (November 24, 2009) New research on bacterial co...tems reveals predictable temporal patterns, sugges...s markers for monitoring climate change in the pol... Proceedings of the National Academy of Sciences ... the six rivers shifted synchronously over time, c...
(Date:11/23/2009)...ember 23, 2009 - The time of day matters to forest...per produced by a research team led by Professor M...,s vice-principal for research and colleagues in t...t. George campus. , Capitalizing on their prev... the research team examined how poplar trees use t...
Breaking Biology News(10 mins):Atomic-level snapshot catches protein motor in action 2Atomic-level snapshot catches protein motor in action 3Atomic-level snapshot catches protein motor in action 4Researchers establish common seasonal pattern among bacterial communities in Arctic rivers 2Time of day matters to thirsty trees, U of T researcher discovers 2Combo Treatment May Ease Depression After Stroke 53891 1Combo Treatment May Ease Depression After Stroke 53891 2Stroke Doubles Risk of Hip Thigh Fractures 53889 1Stroke Doubles Risk of Hip Thigh Fractures 53889 2Stroke Doubles Risk of Hip Thigh Fractures 53889 3Carnegie donates landmark clones to biology 9509 1Carnegie donates landmark clones to biology 9509 2
Other Contentsmicrocephalymidwifemidwifeheadachesheadachesheadachesheadachesheadachesmigrainesmigrainesmigrainesmilia