Navigation Links


Tag: "bonus" at medical news

Better prostate cancer detection

...n routinely uses the extended biopsy now. An added bonus of this technique is that it saves certain patients from having to come back for a second biopsy - when the first is clear but cancer is still suspected....

Re-blockage of heart arteries prevented by vitamins

Vitamins are a bonus to everyone of us. The first ever study of the effect of B vitamins on heart disease shows a clear benefit. Angioplasty is a very widely used procedure for unblocking coronary arteries and so preventing heart attacks. It involves inserting a small ba...

Novel biopsy technique for prostate cancer

...n routinely uses the extended biopsy now. An added bonus of this technique is that it saves certain patients from having to come back for a second biopsy - when the first is clear but cancer is still suspected....

Pomegranate Juice Is Helpful In Arresting Osteoarthritis

...ts to slow the deterioration of human cartilage. A bonus with the native Persian fruit is that its antioxidant constituents are rapidly absorbed by the body and are non-toxic. Using tissue samples of human cartilage affected by osteoarthritis, researchers added a water extract of pomegranate fruit to the ...

Fish Oil Could Soon Be Used In The Treatment Of Depression

...ression levels. If successful, it would serve as a bonus for nearly 60% of multiple sclerosis patients who suffer from depression....

Grandma Recovers Eyesight Miraculously

...d that she has fully recovered, and it is an added bonus that she has also recovered her sight.' Edited IANS...

Promotion of Pneumococcal Vaccine Slow in Europe

...k simply because of their young age. . "An added bonus is that it also appears to protect other unvaccinated members of the community. ....

Ayurveda Boosts Monsoon Tourism in Kerala

...head for our spa aroma therapy. This has come as a bonus and we have already started receiving inquiries for next year's monsoon season," said Muthoot. Most resorts in Kerala offer attractive ayurveda packages to the tourists. These packages include body massages with different herbal oils and powders. ...

Medical Education in Australia Embroiled in Scandals

...tors should be compensated with an extra financial bonus for contributing their mite in the rural areas. The doctors who are ready to retire should be motivated to stay on with incentives. Trained specialists who are working in God forsaken areas should be provided free healthcare and education for familie...

Australia's Baby Bonus Plan has Increased the Birth Rate

.... The rate peaked in the 1960s at 3.55. The baby bonus was introduced in 2004 to halt the decline in the fertility rate. The bounty, which increased at the start of this month to 4,000 Australian dollars ($3,000), is not means-tested and goes to married and unmarried mothers alike. It is also tax-free....

Babies born to drug addicted mothers, treated for drug addictions

... use of discretion during disbursement of the baby bonus sum of $4,000. He suggests that the baby bonus be given as coupons to parents of babies who are still consuming illegal drugs, which can be periodi...

Statins Control Blood Pressure too

...patients using statins to reduce cholesterol get a bonus benefit from such drugs as they seem to have a pos...r antihypertensive drugs. However this is an added bonus for patients already using statins to reduce cholesterol and the use of statins may reduce the dose ...

Exercise may Help Breast Cancer Patients to Lead a Healthy Life

...ed to moderate or household activity. An added bonus of this study was that it emerged that those who maintained vigorous activity levels reported less weight gain and cared more about their appearance. Since excess body weight is associated with increased recurrence of breast cancer and lower surviva...

Suicide Gene Therapy Kills Bowel Cancer Cells

...tandem. And once activated, the drug has the added bonus of causing the virus to produce more of the activating protein, which activates more of the drug, and so on. Its the first time weve seen a positive feedback loop like this in a GDEPT therapy." The drug damages DNA inside the cancer cells to the po...

Genome Annotation by Mutation

...delete large stretches of non-gene DNA, it has the bonus of also being able to disable genes more easily and inexpensively than existing knockout techniques, Wu says....

Health Insurance- Play It Safe And Reap The Benefits

... Not only that, the insured will lose the no-claim bonus as well. Further, his policy will be treated as fresh policy and the first year exclusions will apply again. This aspect is not to be ignored as if a person has a Mediclaim policy and has made no claims on it for four consecutive years, he will sta...

Frustrated With Fad Diets One Man Sets Out to Weed Through The Jungle of Plans

...receive several e-books on diet and nutrition as a bonus for signing up to the newsletter. My goal is to sort through all the glut of diet plans on the internet for my subscribers and discover the true diet plans online that really actually work. I started this process for my own health and have decided ...

1

Other Tagsstabilize 2stabilize 3forming 2forming 3forming 4forming 5forming 6forming 7skills 2skills 3skills 4Other Contentschloroplastschloroplastschordateschordatejumpingjumpingjumpingjumpingwalkwalkwalkwalkwalkwalkwalkwalkchymecircularcircularcircularcircularcircularcircularcircularcircular