Navigation LinksBiology NewsHealth NewsBiology TechnologyMedicine Technology

We're sorry, that page ( was not found.

Search tag 1 application at Google

Search tag 1 application at Yahoo

Search tag 1 application at Bing

(Date:2/16/2017)... 2017  Genos, a community for personal genetic ... received Laboratory Accreditation from the College of American ... laboratories that meet stringent requirements around quality, accuracy ... "Genos is committed to maintaining the ... honored to be receiving CAP accreditation," said ...
(Date:2/10/2017)... , Feb 10, 2017 Research ... report "Personalized Medicine - Scientific and Commercial Aspects" ... ... medicine. Diagnosis is integrated with therapy for selection of treatment ... early detection and prevention of disease in modern medicine. Biochip/microarray ...
(Date:2/8/2017)... Feb. 7, 2017 Report Highlights ... The global synthetic-biology market ... billion by 2021, growing at a compound annual growth rate ... overview of the global markets for synthetic biology. - Analyses ... 2016, and projections of compound annual growth rates (CAGRs) through ...
Breaking Biology News(10 mins):
(Date:2/24/2017)... ... February 24, 2017 , ... Indiana Fiber Network (IFN) President ... later this year. Dyer started as the Chairman of the Management Committee when ... of the corporation including the recruitment of investor/owners and development of the business plan. ...
(Date:2/24/2017)... ... February 24, 2017 , ... Castle Farms, the celebrated ... Wedding Giveaway, with the winning couple announced on Feb. 14, 2017, on Facebook. ... from local vendors: A Matter of Taste, Ryan Rousseau Enterprises, A Touch of ...
(Date:2/23/2017)... (PRWEB) , ... February 23, 2017 , ... ... organization devoted exclusively to funding innovative lymphoma research and serving the lymphoma community ... will return to the La Gorce Country Club in Miami Beach to host ...
(Date:2/23/2017)... Hollywood, CA (PRWEB) , ... February 23, 2017 , ... ... pleased to announce that they are sponsoring a raffle. Throughout the month of February, ... Winners will receive a gift card for a dinner for two at the Cheesecake ...
(Date:2/23/2017)... ... February 23, 2017 , ... Dr. David Mahon leads Siena Dental, ... Dr. Mahon was named a 2017 Top Patient Rated Henderson Dentist by ... directory that recognizes local physicians and dentists who have earned high ratings and superior ...
Breaking Medicine News(10 mins):
Agarose II (Low Melt)...
... monoclonal antibody raised against a partial recombinant NFKBIB. ... a.a. ~ 145 a.a) partial recombinant protein with ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... The BD PhosFlow Perm/Wash Buffer I can ... modified signaling proteins to permeabilize cells and ... cell wash buffer. Because saponin-mediated cell permeabilization ... to keep the cells in the presence ...
Biology Products:
A slide filing system, allows for the convenient storage and retrieval of microscope slides or transparencies. Requires only 48 cm x 48 cm (19 inches x 19 inches) of floor space....
Shandon Slide Mailers and Envelopes...
Shandon Wooden Slide File Storage Box...
Shandon Plastic Slide Boxes...
Medicine Products:
(Date:2/23/2017)... Maryland (PRWEB) , ... February ... ... PathSensors, Inc., announced today that in a published evaluation of multiple immunoassay-based ... a U.S. Department of Energy Laboratory, PathSensors’ CANARY® biosensor threat detection technology ...
(Date:2/23/2017)... Feb. 23, 2017  Capricor Therapeutics, Inc. (NASDAQ: CAPR), a ... conditions, today announced that Linda Marbán, Ph.D, president and chief ... conferences: Cowen and Company 37th Annual ... ET Boston, MA ... am PT (12:00 pm ET) Dana Point, CA ...
(Date:2/22/2017)... Therapeutics, Inc. (NASDAQ: PETX), a pet therapeutics company focused on ... companion animals, will host a live conference call on Tuesday, ... results from the fourth quarter and full year ended December ... access the audio webcast or use the conference ... ...
(Date:2/22/2017)... Scientists propose in Nature blocking ... Gaucher and maybe other lysosomal storage diseases as a ... current therapies. An international research team led ... also included investigators from the University of Lübeck in ... 22. The study was conducted in mouse models of ...
Breaking Biology Technology:
(Date:2/23/2017)... Feb. 23, 2017 Visiomed, the French ... since 1997, is changing the landscape of healthcare ... patients with pro-active, custom-made solutions. Recognizing the rising ... and affordable healthcare without walls, Visiomed has launched ... developed with healthcare professionals that is empowering the ...
(Date:2/23/2017)...  Genesis Healthcare Services has merged with Hospice Cloud, ... Bill Monast , President and CEO of Hospice ... Feltman , executives with Home Health Depot, Inc., the ... This acquisition helps Hospice Cloud maintain its position ... medical equipment (DME) solutions for the hospice industry. ...
(Date:2/23/2017)... , Feb. 23, 2017  Cogentix Medical, Inc. (NASDAQ: ... markets innovative proprietary products for the urology market, will ... year ended December 31, 2016 before the market open ... Company will host a conference call and webcast to ... March 9, 2017 at 11:00 a.m. Eastern Time (10:00 ...
Breaking Medicine Technology: