Navigation Links


Tag: "allocation" at medical news

Radical Change in the Lifestyle Might Bring a Greener Future for Brits

...d carry them on smart cards. Each year the free allocation would decrease as the country moves towards zero carbon, with the effect that the value of the quotas will go up. But every time consumers use fossil fuels, say by filling their cars up with petrol, they would lose these valuable credits, forcing the...

Brits Need to Change Lifestyle to Have a Greener Future: Report

...d carry them on smart cards. Each year the free allocation would decrease as the country moves towards zero carbon, with the effect that the value of the quotas will go up. But every time consumers use fossil fuels, say by filling their cars up with petrol, they would lose these valuable credits, forcing the...

Teens Seems to Be Smoking Less

... deserving of society's strongest support, and the allocation of considerable resources," Katz said. "The trends reported here are worrisome, disturbing, and perhaps even shameful. The tobacco wars wage on, and should we become complacent now, there is no question that lives will be lost as a result."...

Alternative Treatments for Arthritis

... had a major impact, with trials that had adequate allocation concealment showing no glucosamine efficacy. Although trials with industry involvement were more likely to have positive results, they still had varied outcomes (heterogeneity); this may be due to differences in formulations or dosages, although t...

Who Receives a Kidney Transplant First?

...location, particularly as UNOS is reevaluating its allocation system and will receive recommendations from a sub-committee this year. The issue of the allocation of deceased donor organs is not new, and there have been two somewhat conflicting philosophical appr...

Rural Heart Patients Missing Out

...nd treatment. The findings suggest that greater allocation of resources and improved access to specialists and diagnostic support need to be considered for rural and remote populations, to match those in metropolitan areas. The fact that rural and remote patients were hospitalised as often as patients liv...

Government to Amend Birth Registration Act

...d to the work, lack of coordination and inadequate allocation of funds....

Government to Amend Birth Registration Act

...d to the work, lack of coordination and inadequate allocation of funds....

Quality Versus Quantity: Transforming Kidney Transplant Policy

...standards, rather than being directed by arbitrary allocation policies. Freeman claims that such a system would have many benefits, including better educating patients so that they could make informed decisions, allowing patients to personally decide where the trade-off between the qualitative and quantitativ...

Who Receives a Kidney Transplant First?

...location, particularly as UNOS is reevaluating its allocation system and will receive recommendations from a sub-committee this year. “The issue of the allocation of deceased donor organs is not new, and there have been two somewhat conflicting philosophical appr...

Priority Needs to Be Given to Maternal Health in Afghanistan

...s well enshrined in the Holy Quran.' There is an allocation of about 60 million dollars to the project. According to the plan there are three types of involvement in order to save a woman’s life. 'The first one is that you have a trained birth attendant who will be with the woman when she delivers her baby. I...

Cancer Time Bomb Threatening Economic Infrastructure

...g yet.' If there is a tremendous increase in the allocation for health care to treat the cancer patients then it can have an adverse effect in the growing economies of China and India. These countries spent only a fraction of what is spent on health care as compared to the developed economies. The cancer re...

India may See Outbreak of Cardiovascular Illnesses

...future, warns a survey while calling for increased allocation //for public health to combat the grave threat. The country's public expenditure is only 20.7 per cent of the total expenditure on health as compared to Bangladesh's 25.2 per cent, Pakistan's 34.9 per cent and China's 33.7 per cent, says the study....

When 'prevalence' Makes for Disparity in AIDS Care

... AIDS control from state to state. The budgetary allocation also differs, affecting awareness campaigns in north Indian states, with declarations and testing low. Health activists say that this is like "sitting on top of a volcano and waiting for it to start spewing". Tamil Nadu, which has topped the list o...

India to Hike Free Treatments in Fight Against AIDS

...be extended testing and follow-up services with an allocation of Rs.80 billion. Interventions through community-based organisations will be increased from less than five percent now to 50 percent by 2011, said the government. The third National AIDS Programme Implementation Plan was evolved through consulta...

MPs Vow to Fight Malnutrition in Madhya Pradesh

...t funds sanctioned. "Capacity building, resource allocation and growth of existing networks to tackle malnutrition among children appear to be the need of the hour. Awareness should be created among women and support should also be solicited from non-government organisations and self-help groups having better...

Indian Parliamentarians Join to Fight Against TB

...an Singh and Health Minister A. Ramadoss on better allocation of funds for diseases like TB and malaria," said R. Senthil, convenor-secretary of the IMPF. "There has been no new drug to fight TB for the last 43 years. It is time India sets aside some special fund for this and persuades private companies to d...

Research Improves Kidney Transplant Chances for Sensitized Patients

...ng at the algorithm as UNOS reevaluates its kidney allocation system. The committee is expected to make recommen...ecome national policy as part of an overall kidney allocation policy," Dr. Stegall says. "Eighty percent of transplant programs are using the single-antigen bead ...

Union Budget: Impact on Health Sector

...antial funds. In 2007-08, I propose to enhance the allocation for education by 34.2 per cent to Rs.32,352 crore and for health and family welfare by 21.9 per cent to Rs.15,291 crore.' Dissuading smoking has been a high priority and smokers have always paid more for their puffs over the years. This year is ...

Allocation for Health, Education Not Enough: UN Official

Though the allocation in India's budget 2007-08 for health and education...was unhappy with Finance Minister P. Chidambaram's allocation for the health and education sectors, he said, "I am happy that the allocation for these sectors hav...

1 2 3 4

Other Tagsrhesus 2nature 2nature 3nature 4nature 5nature 6nature 7nature 8nature 9nature 10
(Date:11/25/2009)...ire-USNewswire/--WhenmostpeopleheartheacronymTMJ,t...patientsthehelptheyneed.TMJstandsfortheTemporal-Ma...s/connectswithyourskull(temporalbone). ,, Themo...nwithchewing,clickingorpoppingofthejaw.Butmanyothe...adaches,fatigue,sleepdisturbances,irritability,alo...
(Date:11/25/2009)...-SentinelleMedicalInc.,aleadingmanufacturerofbreas...suiteofnewleadingedgeclinicalapplicationsonitsAegi...iologicalSocietyofNorthAmerica(RSNA)annualmeetingi...licationsleveragetheuniquehighqualityimagesgenerat...rtmultipleimagingmodalitiesformulti-parametricasse...
(Date:11/25/2009)...wire/--TheBayAreaAirQualityManagementDistrictisiss... Alert forThursday,November26,2009whichbansbu...bothindoorsandoutdoors. ,, "Cold,stillweatherwi...kBroadbent,executiveofficeroftheAirDistrict."We,re...ghborsandfellowcommunitymembersthisThanksgiving,an...
(Date:11/25/2009)...ew out of a collaboration between UCLA engineers a...nearly 10 million Americans who suffer from periph...ning of the arteries, peripheral arterial disease,...narrowed arteries reduce blood flow to the limbs. ...r disease, heart attack and stroke, and its progre...
(Date:11/25/2009)...on and treatment clinics to resume Monday, Nov. 30...mber 25, 2009 -- Centegra Health System is continu...shots at four Centegra Primary Care (CPC) vaccinat...arrived. The clinics are at CPC sites in Huntley, ...en as follows: ,   From 4:30 to 7:30 p...
Breaking Medicine News(10 mins):Health News:Sentinelle Medical Launches Aegis Suite of Oncology 4D Visualization Software with PureWeb(TM) Technology 2Health News:Sentinelle Medical Launches Aegis Suite of Oncology 4D Visualization Software with PureWeb(TM) Technology 3Health News:Winter Spare the Air Alert in Effect for Thursday, November 26, 2009 2Health News:Engineers, doctors at UCLA develop novel material that could help fight arterial disease 2Health News:Engineers, doctors at UCLA develop novel material that could help fight arterial disease 3Health News:Engineers, doctors at UCLA develop novel material that could help fight arterial disease 4Health News:Centegra H1N1 Vaccination Clinics to Resume Tuesday, Dec. 1 2Health News:Centegra H1N1 Vaccination Clinics to Resume Tuesday, Dec. 1 3Health News:Centegra H1N1 Vaccination Clinics to Resume Tuesday, Dec. 1 4
(Date:11/24/2009)...ystallised a protein that may help gut bacteria bi...d be used by probiotic producers to identify strai.... , "Probiotics need to interact with cells linin... attach to surfaces in the gut they are more likel...ity," says Dr Nathalie Juge from the Institute of ...
(Date:11/24/2009)...W YORK (November 24, 2009) -- The Wildlife Conserv...ling that the last remaining population of Siberia...the rising tide of poaching and habitat loss. , ...ussian officials of what needs to be done to prote...t. , The report was released by the...
(Date:11/24/2009)...vailable in Spanish . , The presence of inc...flammatory substances in the blood, hinders the lo...esearch project of the University of Navarra condu...he School of Pharmacy. , The project, entitled "...to the control of body weight and inflammation," e...
Breaking Biology News(10 mins):A sticky solution for identifying effective probiotics 2Report shows dramatic decline in Siberian tigers 2It can be predicted the reaction obese patients will have to a diet 2Enzyme doesnt act alone in atrial fibrillation 8877 1Enzyme doesnt act alone in atrial fibrillation 8877 2The bitter side of sweeteners 8874 1The bitter side of sweeteners 8874 2BenefitMall Hosts New World of Healthcare Forum to Empower Partners to Find Solutions for Volatile Healthcare Industry 49218 1BenefitMall Hosts New World of Healthcare Forum to Empower Partners to Find Solutions for Volatile Healthcare Industry 49218 2BenefitMall Hosts New World of Healthcare Forum to Empower Partners to Find Solutions for Volatile Healthcare Industry 49218 3
Other Contentsmicrocephalymidwifemidwifeheadachesheadachesheadachesheadachesheadachesmigrainesmigrainesmigrainesmilia