Navigation Links


Tag: "adult" at medical news

Baby Talk Better Than Adult Speech

...owever, it could not distinguish the difference in adult vowel sounds. The researchers claim that this is a...t babies probably understand baby talk better than adult speech because the words are spoken with clearer, more distinct sounds....

Choose your mate

... genetically related increase in the components of adult fitness."...

Leukemia pill shows promise against stomach cancer

...ts. // Approved last spring for a common type of adult leukemia, Gleevec can now be used to treat gastrointestinal stromal tumors, or GIST, which affect as many as 5,000 people in the US each year. Studies have shown it to be as effective in treating chronic cases of GIST as it has been in treating chron...

Obesity a global problem

... and stunted growth may be found hand-in-hand with adult obesity in many places. The phenomenon means countries that still face problems of under-nutrition also need to pay attention to the prevention of obesity-related illnesses, including heart disease, diabetes and cancer. Obesity is also on the increa...

Cleft lip and palate are due to abnormality in brain structure

...archers at the University of Iowa.// Studying 54 adult men with nonsyndromic facial clefts and 54 male control subjects, the researchers used magnetic resonance imaging to study brain volume and tissue composition. They found that the volume of the anterior portion of the cerebrum was enlarged in men wit...

Prescription Drug Use Varies Widely Between States

...use. // According to the study, the percentage of adult beneficiaries obtaining at least one prescription in 2000 ranged from a high of 71 percent in Kansas to a low of 58 percent in California. The average number of prescriptions per member per year varied from 8.3 in New York to 12.2 in Kentucky. Genera...

A question on study of Adult Stem Cell

...tudies may form a tiresome feeling over visions of adult stem cells as a less honestly questionable but nea...g potential. The new findings challenge the notion adult stem cells taken from one tissue can directly produce cell types of other tissues and organs.// It m...

Genetic innovation

...bourne study shows they also help determine normal adult height in the general population....

Sleepwalking has genetic roots

... health problems, like sleep apnoea. A study of 60 adult sleepwalkers in Bern, Switzerland, shows an intere...s REM disorder or sleep apnoea, may help alleviate adult sleepwalking....

FDA considers nicotine lollipops illegal

... if the lollipops pose an immediate health risk to adult smokers, because they are made with a different form of nicotine than is found in nicotine gum, patches or other approved products. That form of nicotine has not been tested for safety. That alone makes the lollipops and lip balm illegal to sell, but...

Stem Cells Have Few Mutations

...ls were actually more genetically stable than some adult cells. Jay A. Tischfield, a researcher at Rutgers ...hat it is actually lower than what you find in the adult cells.// Peter J. Stambrook, a cell biologist at the University of Cincinnati and a co-author of the...

Changing stem cells to liver cells

...at the University of Texas have been able to treat adult bone marrow stem cells so that they become liver cells.// These cells look, stain and function like authentic liver cells. They produce albumin, the most abundant protein made by liver, urea, which is specific to kidney and liver, and P450, the liver...

FDA changes rules on testing drugs for children

...that lets the government require safety testing of adult medicines commonly given to children, a move that has drawn the ire of some Democratic lawmakers. FDA says Congress recently reauthorized financial incentives for manufacturers to do those studies. The FDA said it wants to see if the new law makes th...

Anorexia in boys is common too

...t anorexics, although studies indicate that female adult anorexics are unable to fully regain bone mass after recovering a normal weight. Castro said that since anorexia is relatively rare in boys, it can be difficult for them to accept they have the disorder. For example, during inpatient or day hospital...

Enzyme stimulates growth of adult stem cells

...earchers determine how to harness the potential of adult stem cells to treat a variety of ailments. Stem ce...ointestinal tissue. A long-standing problem with adult stem cells is that they are relatively rare and secluded in the body, which has severely hampered at...

Gene therapy restores sight

...sion and so the researchers were able to work with adult dogs," he said. "In humans, any gene therapy would have to occur before birth". Dr Stone said a further challenge would be identifying the exact genetic defect for LCA."Different people with LCA have defects in different genes, or different parts of...

Stop and think before you eat

...ted with obesity. Being disinhibited also predicts adult weight gain--30 pounds more over 25 years up to age about 60 years. However, "being a restrained eater also helps offset the effect of disinhibition," Roberts added. "Restrained eaters are those who count calories (and) tend to shop for low-fat food...

Impact on Lung function based on exposure

... diagnosis of asthma, early initiation of smoking, adult asthma, and cigarette smoking. Results showed smoking at an early age was related to a faster decline in FEV 1. Having family members who smoked led to early development of asthma, which may also be linked to faster declines in FEV 1 by encouraging ...

Help Quit Smoking

... a finding indicates that more than 92 percent of adult smokers started when they were// in their teen years. Studies indicate that only two out of every ten smokers quit successfully and the the younger you start the more difficult it is to quit. Researchers have developed a new program which guides pa...

Research on Celiac Disease in children

...lable. To date there have been no failures in two adult CD studies, two adult dermatitis herpetiformis studies and now two children CD studies with oats....

1 2 3 4 5 6 7 8 9 10

Other Tagsrhesus 2nature 2nature 3nature 4nature 5nature 6nature 7nature 8nature 9nature 10
(Date:11/25/2009)....25/PRNewswire/-SentinelleMedicalInc.,aleadingmanu...ftwarelaunchesasuiteofnewleadingedgeclinicalapplic...atthisyear,sRadiologicalSocietyofNorthAmerica(RSNA...0,HallA).Theapplicationsleveragetheuniquehighquali...ngcoilsandsupportmultipleimagingmodalitiesformulti...
(Date:11/25/2009)...icalEndorsements,Business,andPressJoinEfforttoEduc...ire/--Onceagain,theNationalBipolarFoundationandthe...heir"Safe,tilStable"program,whichisnowbeingwidelya...order.Today,theNationalBipolarFoundationreceivedap...ailfromtheLt.GovernorofLouisianaMitchLandrieu.TheN...
(Date:11/25/2009)... period was too short to draw definite conclusions...HealthDay News) -- In diabetic patients with block...rence in outcomes at one year whether patients und...British researchers report. , Bypass surgery ha...s with coronary artery disease. However, less inva...
(Date:11/25/2009)...te, CDC sees few signs of trouble with the H1N1 va...y News) -- The ongoing H1N1 swine flu pandemic may... among younger patients, a U.S. health official sa...erious pneumococcal infections around the country,...er for Immunization and Respiratory Diseases at th...
(Date:11/25/2009)...eat colorectal cancer also can reverse a rare stom...herapy for the disease, researchers at Vanderbilt ...rier,s disease causes thickening of the stomach li...as well as anemia and swelling in the feet and ank... risk for gastric cancer. Previously, the only eff...
Breaking Medicine News(10 mins):Health News:Sentinelle Medical Launches Aegis Suite of Oncology 4D Visualization Software with PureWeb(TM) Technology 2Health News:Sentinelle Medical Launches Aegis Suite of Oncology 4D Visualization Software with PureWeb(TM) Technology 3Health News:First Time-Door is Open for Family Discussion of Bipolar Disorder 2Health News:First Time-Door is Open for Family Discussion of Bipolar Disorder 3Health News:Stenting May Equal Bypass for Diabetic Heart Patients 2Health News:Stenting May Equal Bypass for Diabetic Heart Patients 3Health News:Swine Flu Tied to Rise in Pneumonias Among Young 2Health News:Swine Flu Tied to Rise in Pneumonias Among Young 3Health News:Swine Flu Tied to Rise in Pneumonias Among Young 4Health News:Vanderbilt scientists report first effective medical therapy for rare stomach disorder 2
(Date:11/24/2009)...el action of a remarkable class of ring-shaped pro... the Lawrence Berkeley National Laboratory (Berkel...graphy beamline at the Advanced Light Source (ALS)...expression and replication, and are vital to the s...ious agents, such as the human papillomavirus, whi...
(Date:11/24/2009)... (November 24, 2009) New research on bacterial co...tems reveals predictable temporal patterns, sugges...s markers for monitoring climate change in the pol... Proceedings of the National Academy of Sciences ... the six rivers shifted synchronously over time, c...
(Date:11/23/2009)...ember 23, 2009 - The time of day matters to forest...per produced by a research team led by Professor M...,s vice-principal for research and colleagues in t...t. George campus. , Capitalizing on their prev... the research team examined how poplar trees use t...
Breaking Biology News(10 mins):Atomic-level snapshot catches protein motor in action 2Atomic-level snapshot catches protein motor in action 3Atomic-level snapshot catches protein motor in action 4Researchers establish common seasonal pattern among bacterial communities in Arctic rivers 2Time of day matters to thirsty trees, U of T researcher discovers 2Combo Treatment May Ease Depression After Stroke 53891 1Combo Treatment May Ease Depression After Stroke 53891 2Stroke Doubles Risk of Hip Thigh Fractures 53889 1Stroke Doubles Risk of Hip Thigh Fractures 53889 2Stroke Doubles Risk of Hip Thigh Fractures 53889 3Carnegie donates landmark clones to biology 9509 1Carnegie donates landmark clones to biology 9509 2
Other Contentsmicrocephalymidwifemidwifeheadachesheadachesheadachesheadachesheadachesmigrainesmigrainesmigrainesmilia