scanning 1 1
Navigation Links
Tag: "scanning" at medical news
New point scale to ascertain the stroke recovery
...es of recovery. This new method is based on brain scanning using magnetic resonance imaging (MRI), a stroke assessment test and the number of hours between the onset of the stroke and the MRI to determine the severity of the stroke. The size of the stroke abnormalities in the brain as a result of blood clot...Drug abuse leads to long standing changes in the brain
...echnique called positron emission tomography (PET) scanning to measure the levels of molecules called dopamine...cond study, Dr. Volkow and her colleagues used PET scanning to measure glucose metabolism in the brains of the same group of methamphetamine abusers and in cont...Bar Codes For Prescribed Drugs
...alth system has already moved to purchase bar code scanning systems, but is being hampered because most products still lack the codes. Such a proposal could be technically challenging, but potentially time-consuming and very expensive....Dyslexia due to cerebellum abnormality
... of eight normal and eight dyslexic adults using a scanning technique called positron emission tomography (PET). patients were monitored as they performed a pre-learned sequence of right hand finger movements, and as they learned a new sequence of finger movements, also with their right hand. During the tas...New technique to diagnose heart disease
...s used to diagnose heart problems. A new method of scanning based on magnetic resonance imaging is proving to be a useful alternative to conventional methods for diagnosing heart problems.//The usual technique for diagnosing blocked arteries that are the cause of heart disease involves injecting a dye into th......e physical structure of the brain. But using a new scanning technique, doctors have established that cluster headaches are likely to be caused by excessive growth of grey cells in one part of the brain. By using the latest imaging techniques, Professor Goadsby and colleagues found an increase of grey matter...By the use of novel scanning methods doctors have found that cluster headaches are due to excessive gray cells in the brain. It is the section that governs the body clock, which could be responsible for the regularity of the headaches' aspect.// Cluster headaches are marked by...Scientists found ancient Human Germ Killer
...re appeared to be no comparable human defensin. By scanning the human genome, they found a place where the molecular sequences was nearly 90 percent identical to the monkey gene for RTD-1. However, inside the human gene was a mutation that prevented it from working, as if an extra, meaningless chain of lette...Hyperactivity disorder a biological malfunction
...anning. The abnormality was revealed by a magnetic scanning device// which enabled researchers to look at the ...chiatry at the Medical Research Council, said this scanning technique had strenghtened claims that the controversial disease has a biological cause. ADHD child...Effect of Osteosarcoma predicted by scans
...have been studying about the outcome of the hitech scanning technologies recently. A scan that looks at glucose uptake in a tumour shows who has a poor prognosis. Osteosarcoma is a bone tumour which affects mainly younger people. //It's an unusual cancer and one where the outcome tends to be rather unpredicta...Associated scan for detecting ovarian cancer spread
...dominal cavity. Positron emission tomography (PET) scanning is useful// for detecting the activity of tumour tissue, while computed tomography (CT) is good for imaging anatomical detail. Researchers at Johns Hopkins Medical School have found that combining the two detects ovarian cancer spread better than usi...New virtual colonoscopy procedure for easier colon screening
...e been using. This procedure// allows computerized scanning of the colon which is more comfortable for the patient. The patient is made to lie down in a computerized tomography (CT) scanner while a small probe is inserted into the rectum so that the colon can be inflated with carbon dioxide gas. The CT scanne...Early Detection of Lung Cancer
...mputed tomography and positron emission tamography scanning to uncover the cancer before it becomes more diffi...r up to five years. As with previous studies of CT scanning for lung cancer, nodules were identified in a significant percentage of the group -- 29 percent. Mos...Head injury X-rays may actually be causing harm
... the head. The authors of the research say that CT scanning after minor head trauma now needs to be reconsidered. A team from the Karolinska Institute in Stockholm, with colleagues in Harvard and Athens, followed up more than 3,000 men who had been given radiation treatment for haemangioma, an excessive gro...Radiation Exposure Found To Affect Intellect Later In Life
...researchers say the risks and benefits of using CT scanning for young children need to be re-evaluated.// Researchers from Sweden studied more than 3,000 men who received radiation therapy before 18 months of age. Participants had their intellectual capacity tested at age 18 years or 19 years. Researchers al......r up to five years. As with previous studies of CT scanning for lung cancer, nodules were identified in a sign...say additional study is required to see if regular scanning for lung cancer can reduce mortality from the disease....Detecting Lung Cancer In Its Initial Stages
...r up to five years. As with previous studies of CT scanning for lung cancer, nodules were identified in a sign...say additional study is required to see if regular scanning for lung cancer can reduce mortality from the disease....Understanding The Harmful Effects Of Radiation Exposure
...researchers say the risks and benefits of using CT scanning for young children need to be re-evaluated.// Researchers from Sweden studied more than 3,000 men who received radiation therapy before 18 months of age. Participants had their intellectual capacity tested at age 18 years or 19 years. Researchers als...MRI screenings may be better to identify breast cancer
... a history of breast cancer in their families, MRI scanning does score more than mammography. Researchers feel that women who have a family history of breast cancer are predisposed to the disease genetically. These women will benefit from being screened for breast cancer from early adulthood. Screening young...MRI for distinguishing between dementia and Alzheimer’s diseas
...ology of the disease is different as well, the new scanning technique will help the physicians make an early diagnosis based on the non-invasive scan images. Brain blood flow is usually measured by using positron emission tomography or single proton emission computerized Tomography that involves injecting th...Other Tagsavoidance 2avoidance 3torn 2suspected 2suspected 3suspected 4suspected 5suspected 6suspected 7suspected 8huge 2huge 3huge 4huge 5huge 6huge 7huge 8huge 9huge 10conventional 2conventional 3conventional 4conventional 5conventional 6conventional 7conventional 8conventional 9conventional 10suicide 2region 2region 3region 4region 5region 6region 7region 8region 9region 10Other Contentsridgeridgemicrocephalymidwifemidwifeheadachesheadachesheadachesheadachesheadaches
(Date:11/30/2009)...30 At a briefing of the...and the Consortium for Citizens with Disabilities ...ic Policy and Advocacy for NCOA, called on Congres...sponds to the growing crisis in long-term care for...ns of seniors, after working hard all their lives,...
(Date:11/30/2009)...mic is far from over. Every year, almost three mi...lion die from AIDS-related diseases." ,, WASHI... AIDS Day 2009 the Global AIDS Alliance (GAA) call...n two recent alarming reports from the World Healt...c continues to be of catastrophic proportion, affe...
(Date:11/30/2009)...g significant impact, CBO analysis understates the...ewswire/ -- The Blue Cross and Blue Shield Assoc...rding the estimate released today by the Congressi...irmed what many economists, actuaries, and health ...lthcare reform bill would make coverage more expen...
(Date:11/30/2009)...s equivalent to 113 chest X-rays, study finds , ... than half of patients who have abdominal/pelvic C...ts that expose them to extra radiation, U.S. resea...d pelvic series were performed on 500 patients age...30 to 50 years of age. The researchers concluded t...
(Date:11/30/2009)... 30 SEIU Local 21LA mem...ration Sodexo will hold a rally Tuesday, Dec. 1, 2...headquarters, 3800 Desire Parkway, New Orleans, to...y disciplinary policies that target employees who ...er. Sodexo employees who clean schools in the Reco...
Breaking Medicine News(10 mins):Health News:NCOA, Bedlin Brief Leading Aging Organizations on Health Care Reform, Needed Long-Term Care Provisions 2Health News:GAA Calls on President Obama to Act on the Reality of AIDS 2Health News:GAA Calls on President Obama to Act on the Reality of AIDS 3Health News:CBO Confirms That Premiums Will Increase Under the Senate Healthcare Reform Bill 2Health News:CT Scan Patients May Get Unnecessary Imaging 2Health News:As H1NI Hits New Orleans in Force: School Custodians to Hold Rally to Call on Contractor to Stop Penalizing Workers Coping With Illness 2[0] NCOA, Bedlin Brief Leading Aging Organizations on Health Care Reform, Needed Long-Term Care Provisions[0] GAA Calls on President Obama to Act on the Reality of AIDS[0] CBO Confirms That Premiums Will Increase Under the Senate Healthcare Reform Bill[0] CT Scan Patients May Get Unnecessary Imaging[1] As H1NI Hits New Orleans in Force: School Custodians to Hold Rally to Call on Contractor to Stop Penalizing Workers Coping With Illness
(Date:11/30/2009)...ratures continue to rise scientists are presented ...ecies respond and adapt. In a paper published in ...odriguez-Trelles and Dr Miguel Rodriguez assess th... of approximately 0.6˚C has already affected ...ng ecologists and evolutionary biologists is to pr...
(Date:11/30/2009)...report published in the December 2009 print issue ...lar type of control over their fertility that wome...sts have found how and where androgenic hormones w...on and male fertility. This opens a promising aven...discovery also offers hope to those who cannot hav...
(Date:11/26/2009)...r impressive antlers, red deer have been caught in... antlers are much more than decorative. They are l...ing. John Currey, from The University of York, UK,...f bone for over half a century and has become fasc...ugh a long-standing collaboration with Tomas Lande...
Breaking Biology News(10 mins):How can scientists measure evolutionary responses to climate change? 2Tough yet stiff deer antler is materials scientist's dream 2Deerfield Spa The Poconos Most Affordable Destination Spa Schedules Ribbon Cutting Event for Grand Opening of New Day Spa 51478 1Deerfield Spa The Poconos Most Affordable Destination Spa Schedules Ribbon Cutting Event for Grand Opening of New Day Spa 51478 2Hologic to Present at the 29th Annual Canaccord Adams Global Growth Conference 51475 1Hush little baby Linking genes brain and behavior in children 9237 1Hush little baby Linking genes brain and behavior in children 9237 2| Copyright © 2003-2009 Bio-Medicine. All rights reserved. ABOUT | CONTACT US | DISCLAIMER | PRIVACY POLICY | TERMS AND CONDITIONS |  |