Navigation Links


Tag: "receiving" at medical news

Painkillers Do Not Shorten Dying Patients' Lives

... St Christopher's Hospice in London claim patients receiving higher doses of drugs such as morphine live just as long as those who do not. In research published in The Lancet medical journal, they compared the doses of painkillers given to 238 dying patients to determine the impact on their survival."There i...

Transdermal HRT not cardioprotective in postmenopausal women with CAD

... MI or premature death from heart disease in women receiving HRT and women not receiving the therapy. Respectively, the average event rates were 15.6 and 12.6 per 100 patient-years. Results...

Transdermal HRT not cardioprotective in postmenopausal women with Coronary Artery Disease

... MI or premature death from heart disease in women receiving HRT and women not receiving the therapy. Respectively, the average event rates were 15.6 and 12.6 per 100 patient-years. Results...

ATG useful in transplant patients as substitute for steroids

...in the steroid group, and only 50 percent of those receiving rabbit ATG developed recurrent hepatitis C or diabetes, compared to 70 percent of those on steroid treatment. For those who are contemplating transplants but are worried about rejections and other steroid induced reactions these words of Dr. Eason ...

TIZANIDINE - New solution to chronic headache

...51% in the drug group, compared to 34% in patients receiving the placebo. 'Not only did the treatment with tizanidine reduce the amount of analgesic required by the patient, it seemed to work more efficiently on reducing the frequency of the most severe headaches', said Lake. Hence don’t worry migraineites !...

Soluble IL-4 Receptor - A new boon for asthmatics

...V1; however, lung function did decline among those receiving placebo. This study is "the first...to demonstrate the potential clinical efficacy of a TH2 inhibitor for the treatment of asthma," the investigators note. This soluble IL-4 receptor, which isn't a corticosteroid, selectivelyinhibits allergic mecha...

Maternal alcohol consumption linked to behavioral problems in children

... In their study which included 506 women, who were receiving prenatal care were made to answer questions about their alcohol consumption during their pregnancy.These women were contacted again when their children were between 6 and 7 years of age. The investigators found that on examining the behavioural patt...

Iron supplements proves helpful in dry cough .

...jects who had developed persistent dry cough while receiving ACE inhibitors for various heart conditions, found that the cough severity decreased following the supplementation with iron. The subjects scored their symptoms on the basis of its severity which ranged from no cough (0) to severe cough that persist...

Acupuncture provides relief

...undergoing treatment still thinks of themselves as receiving a valid form of acupuncture treatment. But the small difference between the acupuncture group and the control group suggests the laser substitute might still be stimulating the nerves and so not controlling properly for the effect of needle insertio...

Stop smoking and reduce weight

...herapy group. Surprisingly, the women in the group receiving therapy to allay their concerns about weight gain fared the best in terms of preventing weight gain. At one-year follow-up after treatment, they had gained less weight than women in either the weight control or the standard therapy groups. Women in t...

Toxic effects common with AIDS treatments

...hort Study, identified 1,160 HIV-positive patients receiving antiretroviral treatment for their condition. The researchers found that 47 per cent of patients taking part in the study exhibited clinical and 27 per cent exhibited laboratory evidence of drug-related adverse effects. Analysis of symptoms revealed ...

Acupuncture can ease cancer

...ring the five following days was six, 11 for those receiving the less intense acupuncture, and 16 for those simply taking anti-emetics. The authors are now recommending that hospitals offer the treatment to patients in whom conventional drugs have failed to prevent vomiting. Mark Bovey, a research co-ordinat...

Cost-effective antibiotics for sinusitis treatment

... 29,102 adults with a diagnosis of acute sinusitis receiving initial antibiotic treatment. The antibiotic treat...rate was 90.1 per cent and for the 11,773 patients receiving second-line treatment the success rate was 90.8 per cent. Although the success rate in both types ...

Inadequate epilepsy treatment

...with up to 20 per cent of UK epilepsy patients not receiving appropriate drugs, researchers say. Around 30,000 people are diagnosed with epilepsy each year, and of these, about one-third can be expected to continue on long-term medication. But researchers from the Institute of Neurology at University College L...

Woman gets cancer from transplanted kidney

For a person with failing kidneys, receiving a transplanted kidney can be a lifesaver. But in rare cases, the transplanted organ may pass on cancer to the recipient. Wisconsin researchers report that a transplant recipient whose donor had previously had lung cancer developed cancer herself sev...

Zinc supplements improve survival rate

...ne months. Fifteen of the 20 who died had not been receiving zinc supplements. The findings follow previous studies showing zinc can boost growth when given// to breast-fed infants, and can help make babies bigger and healthier if taken by pregnant women. Zinc deficiencies can impair the body's ability to f...

Evidence supporting H.pylori eradication

...lleagues recruited 100 arthritis patients who were receiving long-term NSAID treatment to participate in the investigation. The patients were randomly allocated to H.pylori eradication with omeprazole triple therapy or to placebo treatment with omeprazole for one week. The patients continued on NSAID treatment...

Medications for depression

...2.5 per 100 over this time.The proportion of those receiving drug treatment for depression increased from 30 pe...side effects. By contrast the number of patients receiving psychotherapy for depression declined from 60 per cent to 50 per cent. Physicians now seem to be mor...

Osteoporosis associated with Childhood Cancer

...rradiation lead to increased bone loss. Patients receiving between lower doses of radiation demonstrated no less bone loss than patients not receiving cranial irradiation at all. This finding leads researchers to believe that irradiation of the pituit...

Foremost gene therapy for chest pain

...rance - as measured by a treadmill test - in those receiving the gene therapy. This was just a small study which needs to be repeated in a larger group, but the results look highly encouraging....

1 2 3 4 5 6 7 8 9 10

Other Tagsavoidance 2avoidance 3torn 2suspected 2suspected 3suspected 4suspected 5suspected 6suspected 7suspected 8huge 2huge 3huge 4huge 5huge 6huge 7huge 8huge 9huge 10conventional 2conventional 3conventional 4conventional 5conventional 6conventional 7conventional 8conventional 9conventional 10suicide 2region 2region 3region 4region 5region 6region 7region 8region 9region 10
(Date:11/30/2009)...30 At a briefing of the...and the Consortium for Citizens with Disabilities ...ic Policy and Advocacy for NCOA, called on Congres...sponds to the growing crisis in long-term care for...ns of seniors, after working hard all their lives,...
(Date:11/30/2009)...mic is far from over. Every year, almost three mi...lion die from AIDS-related diseases." ,, WASHI... AIDS Day 2009 the Global AIDS Alliance (GAA) call...n two recent alarming reports from the World Healt...c continues to be of catastrophic proportion, affe...
(Date:11/30/2009)...g significant impact, CBO analysis understates the...ewswire/ -- The Blue Cross and Blue Shield Assoc...rding the estimate released today by the Congressi...irmed what many economists, actuaries, and health ...lthcare reform bill would make coverage more expen...
(Date:11/30/2009)...s equivalent to 113 chest X-rays, study finds , ... than half of patients who have abdominal/pelvic C...ts that expose them to extra radiation, U.S. resea...d pelvic series were performed on 500 patients age...30 to 50 years of age. The researchers concluded t...
(Date:11/30/2009)... 30 SEIU Local 21LA mem...ration Sodexo will hold a rally Tuesday, Dec. 1, 2...headquarters, 3800 Desire Parkway, New Orleans, to...y disciplinary policies that target employees who ...er. Sodexo employees who clean schools in the Reco...
Breaking Medicine News(10 mins):Health News:NCOA, Bedlin Brief Leading Aging Organizations on Health Care Reform, Needed Long-Term Care Provisions 2Health News:GAA Calls on President Obama to Act on the Reality of AIDS 2Health News:GAA Calls on President Obama to Act on the Reality of AIDS 3Health News:CBO Confirms That Premiums Will Increase Under the Senate Healthcare Reform Bill 2Health News:CT Scan Patients May Get Unnecessary Imaging 2Health News:As H1NI Hits New Orleans in Force: School Custodians to Hold Rally to Call on Contractor to Stop Penalizing Workers Coping With Illness 2
(Date:11/30/2009)...ratures continue to rise scientists are presented ...ecies respond and adapt. In a paper published in ...odriguez-Trelles and Dr Miguel Rodriguez assess th... of approximately 0.6˚C has already affected ...ng ecologists and evolutionary biologists is to pr...
(Date:11/30/2009)...report published in the December 2009 print issue ...lar type of control over their fertility that wome...sts have found how and where androgenic hormones w...on and male fertility. This opens a promising aven...discovery also offers hope to those who cannot hav...
(Date:11/26/2009)...r impressive antlers, red deer have been caught in... antlers are much more than decorative. They are l...ing. John Currey, from The University of York, UK,...f bone for over half a century and has become fasc...ugh a long-standing collaboration with Tomas Lande...
Breaking Biology News(10 mins):How can scientists measure evolutionary responses to climate change? 2Tough yet stiff deer antler is materials scientist's dream 2Deerfield Spa The Poconos Most Affordable Destination Spa Schedules Ribbon Cutting Event for Grand Opening of New Day Spa 51478 1Deerfield Spa The Poconos Most Affordable Destination Spa Schedules Ribbon Cutting Event for Grand Opening of New Day Spa 51478 2Hologic to Present at the 29th Annual Canaccord Adams Global Growth Conference 51475 1Hush little baby Linking genes brain and behavior in children 9237 1Hush little baby Linking genes brain and behavior in children 9237 2
Other Contentsridgeridgemicrocephalymidwifemidwifeheadachesheadachesheadachesheadachesheadaches