Navigation Links


Tag: "mediterranean" at medical news

Mediterranean diet aids Asian masses

A diet rich in alpha-linoleic acid reduced cardiac events in Asian people at risk.Coronary artery disease (CAD) is a major public health problem in South Asian people, especially if they move to the West. The high prevalence of CAD is not fully explained by conventional risk factors,// like diabetes and high blood pressure. ....Researchers in India and Israel have been experimenting with the eff...

The Mediterranean magic: helpful in heart disease

The magic of the Mediterranean diet has been widely talked about and largely accepted. In the same direction is another study conducted in France which proclaims that there is a 15% reduction in the risk of heart disease //on consumption of a Mediterranean diet for a period of three months. .. ..The sample size was 212 men and women who were at moderate risk for heart disease were put to eat a Me...

Mediterranean Diet Lowers Inflammation Levels In Elderly

Researchers from the Stanford School of Medicine in California say that following a Mediterranean diet consisting of plenty of fruits// and vegetables and holding off saturated fats decreases the level of inflammation in the aged and elderly people. This is substantiated by the reduced levels of C-reactive protein (CRP) in such individuals. ..The reserachers tracked the level of CRP in the blood...

Risk Of Dementia May Be Reduced By Mediterranean Diet

According to a new study, a Mediterranean diet with low saturated fat and high fibre content could reduce the risk of developing dementia. // ..The Mediterranean diet is a nutritional model inspired by the traditional dietary patterns of the countries of the Mediterranean basin, particularly Italy, Greece, Portugal and Spain. The diet comprises high consumption of fruit and vegetables, bread an...

Mediterranean Diet Effective in Staving off Risk of Alzheimer’

According to a recent finding, Americans whose diet was Mediterranean, that included lots of fruits, vegetables, legumes, cereals, some fish and alcohol, and little dairy and meat, certainly had a low risk of Alzheimer's disease as they aged.// These findings have been published in the April issue of Annals of Neurology. ....According to stalwarts in the field of diet , Alzheimer’s development is...

Mediterranean Diet And Exercise, Key To Good Health

Exercising for at least for half an hour a day and indulging in a Mediterranean diet, which is based on a rich serving of vegetables and fish, may be the key// to longevity and good health, highlights a new study conducted by the World Health Organization. ..According to the study, exercising just 30 minutes a day can add five years to your life. Walking, cycling and even climbing the stairs are...

Mediterranean Diet And Exercise Increases Life Expectancy

At least half an hour of exercise a day and eating a Mediterranean diet, rich in fish and vegetables, may keep you healthy and increase your life// expectancy, says a study by WHO. ....According to the study, exercising just 30 minutes a day can add five years to your life. Walking, cycling and even climbing the stairs are included in the tally, reported THE online edition of Daily Mail. ....Sim...

Alzheimer’s Risk Lowered with 'Mediterranean' Die

A "Mediterranean" diet rich in olive oil, vegetables, fruits, legumes, cereals and fish have a lower risk of developing// Alzheimer's disease according to U.S. researchers. ..Lead researcher Dr. Nikolaos Scarmeas, an assistant professor of neurology at Columbia University Medical Center in New York said, "We have confirmed the association of a Mediterranean diet with Alzheimer's disease." ..Scar...

Mediterranean Diet Could Help to Prevent COPD

A study conducted to understand dietary patterns and chronic obstructive pulmonary disease among men has discovered that Mediterranean diet halves the chances of developing progressive inflammatory lung disease (COPD). ......COPD (chronic obstructive pulmonary disease) is an umbrella term for chronic progressive lung disease, such as emphysema and bronchitis. ......The researchers tracked the...

Present Rate of Carbon Emissions Could Increase Number of Hot Days in Mediterranean by 500 Pc

The number of hot days in the Mediterranean by the end of the 21st century could show a 200 to 500 percent increase if the current rate of greenhouse gas emissions continue , according to a joint study by American and Chinese scientists. ...France would be subjected to the largest projected increase of high-temperature extremes, the study by researchers from the Purdue University and the Interna...
Other Tagsteacher 2teacher 3dried 2dried 3fruits 2prolong 2
(Date:11/29/2009)...ment equals a $41,000 pay raise, researchers say ,... Psychological therapy may be much more effective ...ning a lottery prize, suggests an English study. ,...le who provided information about their mental wel...rom a $1,329 course of therapy was so significant ...
(Date:11/29/2009)...ealthcare,s uncertain future and rising costs open...Affordable Acupuncture Scottsdale answers the call...2009 -- Affordable Acupuncture, LLC opened in Scot...t with enthusiasm and gratitude. Its increasing po...o things, need and cost. "As far as I’...
(Date:11/28/2009)...nsider change after 30-minute psychosocial interve...HealthDay News) -- A program that gets persistent ...ir dangerous behavior may lead to significant and ... The new study included 184 men and women with two...ere randomly assigned to one of two interventions....
(Date:11/27/2009)...RNewswire-FirstCall/ -- GSI Group Inc. (Pink Sheet...technology products and semiconductor systems, tod...,s shareholders has been scheduled for Friday, Apr... will be announced in due course. As previously a...e from Stephen Bershad, a holder of greater than t...
(Date:11/27/2009)...-USNewswire/ -- Considered a highly risky and cont...id organ transplantation is now a life-saving main...nd women who gathered at the Winspear Opera House ...edical centers around the world to celebrate the 2...itute (BRTI), one of the pioneers of solid organ t...
Breaking Medicine News(10 mins):Health News:Psychotherapy Can Boost Happiness More Than Money: Study 2Health News:Affordable Acupuncture Greeted with Open Arms by Scottsdale and Phoenix Communities 2Health News:Drunk Drivers May Respond to Brief Motivational Interview 2Health News:GSI Group Calls Shareholders Meeting 2Health News:Organ Transplant Pioneers Celebrate Baylor Regional Transplant Institute's 25th Anniversary 2Health News:Organ Transplant Pioneers Celebrate Baylor Regional Transplant Institute's 25th Anniversary 3
(Date:11/24/2009)...4, 2009) New research on bacterial communities th... predictable temporal patterns, suggesting that sc...r monitoring climate change in the polar regions. ... of the National Academy of Sciences Early Editio...ers shifted synchronously over time, correlating w...
(Date:11/23/2009)...sents strong evidence that the "synergistic" effec...elated pollution and indoor endotoxin causes more ...osure alone. , Environmental health scientists...edicine have shown that children exposed to both h... endotoxin during early life are six times more li...
(Date:11/23/2009)...mber 23, 2009 Applied mathematicians dissected th...ia ), a characteristic long leaf with a saddle-lik...the edges. The simple cause of the lily,s fan-like...ring differential growthwas revealed by using an e..., Haiyi Liang, a postdoctoral student at Harvard...
Breaking Biology News(10 mins):Researchers establish common seasonal pattern among bacterial communities in Arctic rivers 2Exposure to both traffic, indoor pollutants puts some kids at higher risk for asthma later 2The cause behind the characteristic shape of a long leaf revealed 2Health Care Training a Great Option for Back to School Career Seekers 56327 1Health Care Training a Great Option for Back to School Career Seekers 56327 2Pew Commissioned Poll Finds Nine in Ten Iowa Voters Support More Government Oversight of Food 56323 1Pew Commissioned Poll Finds Nine in Ten Iowa Voters Support More Government Oversight of Food 56323 2Pew Commissioned Poll Finds Nine in Ten Iowa Voters Support More Government Oversight of Food 56323 3Hissey Kientz LLP Urges Patients To Heed FDA Warning About Phospho soda Products 56320 1Hissey Kientz LLP Urges Patients To Heed FDA Warning About Phospho soda Products 56320 2Hissey Kientz LLP Urges Patients To Heed FDA Warning About Phospho soda Products 56320 3Hissey Kientz LLP Urges Patients To Heed FDA Warning About Phospho soda Products 56320 4
Other Contentschloroplastschloroplastschordateschordatejumpingjumpingjumpingjumpingwalkwalkwalkwalkwalkwalkwalkwalkchyme