Navigation Links


Tag: "bet" at medical news

Consume Less, Experts Advise as Malthusian Nightmare Returns to Haunt West

...s. "If oil jumps from $60 a barrel to $80, you can bet that your supermarket bills will also go up." In the developed world this could mean a change of lifestyle. Elsewhere it could cost lives. Soaring food prices have already sparked riots in poor countries that depend on grain imports. More will foll...

Strategy to Reduce Blood Pressure in Low-income African American Men

... a blend of medication and education// is the best bet to reduce hypertension. There were 309 African American men participating in the study. At the start of the study, 50% of the men were arbitrarily assigned an intensive program combining free medication, health education and social support. The re...

Beta Carotene Pills Do Not Remedy Age-related Macular Degeneration

...when combined with vitamins and zinc. But the best bet is to consume atleast five servings of fruits and vegetables on a daily basis, to offset risks of age related macular degeneration. SAV...

Where Burnt Out Executives De-stress in Nature's Lap

...wildlife lovers must include in their itinerary. I bet nobody would go disappointed from here." Source-IANS...

Bottleneck for Neck Stents - May Enhance Risk of Stroke, Says a Study

...ch which had proved that stents were indeed a safe bet to do away with blockages in the carotid artery. To make a comparative study, researchers used stents and a surgical method to clear the blocks in the carotid artery. Alarmingly the researchers found that strokes and death risk increased two fold ...

World Alzheimer’s Day: In Memory of Those With 'Memory Loss

...e the advancement of Alzheimer's disease. The best bet so far combines the expertise of psychotherapy, environmental changes and medication. The pitfalls of drug therapy for patients who are already suffering memory impairment can get worse because of the inability to remember to take a drug, and more so...

Wear and Tear of Stress: The Psychoneurobiology of Aging

...choneuroendocrinology. And healthy aging is a good bet if stress can be moderated along with adopting an active, healthy lifestyle. This finding will be presented at the 114th Annual Convention of the American Psychological Association (APA). From a review of studies on how stress hormones affect the b...

Family, Books Best Stress-busters for Indian CEOs

... pranayama, or breathing exercises, are their best bet for getting rid of stress. "Interestingly, the CEOs in India said that their peers in the US, Europe and China suffer more stress," the report states. The survey found ample reason to support the belief of Indian CEOs that they are better off tha...

Flesh, blood and a few dollars more

... This might seem sickening, but there are many who bet on their dear ones falling sick and dying and if that happens, //they hit the jackpot and become a few million dollars richer. This trading or betting on someone’s life is unabashedly termed 'Life Insurance', a must-have in today’s world. Life insur...

The Face Of Indian Health Care: A World Health Day Evaluation

... single baby girl would mean nothing at all. But I bet the poor mother would dare to become pregnant again. July 2005, India: Ultaf Bi, a resident of Savali village in Karnataka presents to a primary healthcare centre in her village, with complaints of stomach ache. She was ordered to receive an inject...

Wholly Ingrained: White or Brown? Food War Going Racist? Get to the Heart of the Matter

... the grains from whole grain sources, and the best bet will be substitute one grain for another , instead of just piling on. ...

Voice Choice: Woo Men, Strike a Deep Chord

... and healthy genes, the combination being the best bet for successful procreation. Earlier research had also indicated that women were drawn to raw masculinity, good looks and macho appeal, during the fertile phase. A Deep voice indicated high levels of testosterone But when the fertility phase passes, ...

Calcium in isolation no good for maintaining bone integrity

...-vitamin D supplements at an older age. People who bet their health on supplements may be looking for trees while forgetting about the forest. ...

You Can Be Emotional And Logical

...ning an equal number of red and blue cards, and to bet on whether they were right. In the other game, the ratio of red to blue cards remained unknown. Players in this game were less likely to put money on their guess. And there was a burst of activity in their brain's emotion-processing centers, the on...

Bird Flu Spreading in China's Poultry

...ay that vaccinating domestic poultry is their best bet in severing the transmission link between wild and tame birds. Bird Flu dominates summit: The bird flu threat loomed large at the 21-member Asia Pacific Economic Cooperation summit that began Friday. Australian Prime Minister John Howard urged...

Mattresses do Play a Role in Low Back Pain

...ence. //Three-quarters of physicians say your best bet is a firm bed mattress, but a new study says they could be wrong. The new research finds medium-firm mattresses are more effective at relieving back pain. Physicians often get frustrated when patients ask them what type of bed is best for their low...

New Drug to Stop Gambling!

...t in many, many ways." And that's something he can bet on. However experts say the drug can cause liver problems if mixed with other drugs, such as over-the-counter painkillers....

Ways to handle ugly toenails

...// and decide not to treat the infection, the best bet is to keep the toenails short and neat. Feet should be first soaked in water to soften nails for trimming. Long handled clippers can be used for good grip and control and nails should be cut straight across to reduce risk of ingrowing nails. Wearing ...

1

Other Tagspreparedness 2preparedness 3assault 2assault 3thanks 2thanks 3thanks 4thanks 5conserving 2
(Date:12/4/2008)...edical university Karolinska Institutet have deter...ential for the interaction between the mammalian e...ure , gives a first glimpse into the molecular arc...ications for the future of human reproductive medi...aceptives. , The beginning of every new life sta...
(Date:12/4/2008)...4 AARP CEO Bill Novelli...n to the latest Congressional efforts to help fail...com.com/cgi-bin/prnh/20070209/NYF043LOGO ) , ... get worse if we allow America,s biggest automaker...g these corporations go under -- taking with them ...
(Date:12/4/2008)...ewswire/ -- Getting back in the gym and,erasing y...arge amounts of,weight because your health depend...a,s #1 Selling Protein*, is joining forces with NB... help contestants and viewers retake control of,t...t, The Biggest Loser,Protein by DESIGNER WHEY, wh...
(Date:12/4/2008)...swire/ -- Qforma, an advanced analytics and predi...tment of Kent Harris as Senior Vice President of S...egarded in the pharmaceutical industry and is an i... Kelly D. Myers, CEO of Qforma. "He brings nearly ...ve record of measurable results. His success in sa...
Breaking Medicine News(10 mins):Health News:Crystallography reveals the 3-D structure of mammalian sperm receptor 2Health News:AARP: Health Care and Pension Reform Critical to Economic Recovery 2Health News:AARP: Health Care and Pension Reform Critical to Economic Recovery 3Health News:DESIGNER WHEY to Help Contestants and Fans of NBC's The Biggest Loser Shed Pounds 2Health News:DESIGNER WHEY to Help Contestants and Fans of NBC's The Biggest Loser Shed Pounds 3Health News:DESIGNER WHEY to Help Contestants and Fans of NBC's The Biggest Loser Shed Pounds 4Health News:Qforma Appoints Kent Harris as Senior Vice President of Sales 2
(Date:12/3/2008)...mber 3, 2008 Today, the International Society for...rofessional organization of stem cell researchers,...opment of safe and effective stem cell therapies f...the Guidelines for the Clinical Translation of Ste...ember issue of Cell Stem Cell , the official affi...
(Date:12/3/2008)...s that are high in protein and cereal grains produ...e calcium excretion and weaken bones, according to...rine Society,s Journal of Clinical Endocrinology ...asing the alkali content of the diet, with a pill ...s the opposite effect and strengthens skeletal hea...
(Date:12/2/2008)...ec. 2 Neurotechnology,( http://ww...dentification,technologies, today announced that ...i-biometric technology to identify duplicate regis...ladesh Voter Registration Project registered,more... fingerprint technology.,After evaluating a numbe...
(Date:12/2/2008)...In a study in the advance online edition of Natur...rom Albert Einstein College of Medicine describe ...ental step of a cell,s life a gene, DNA, being re...de a window into the process by which genes are sw...he new technique provides a detailed look into pro...
Breaking Biology News(10 mins):The International Society for Stem Cell Research releases new guidelines 2The International Society for Stem Cell Research releases new guidelines 3Calcium and vitamin D may not be the only protection against bone loss 2Bangladesh Voter Registration Project Now Using MegaMatcher Biometric Technology to Detect and Prevent Duplicate Registrations 2Bangladesh Voter Registration Project Now Using MegaMatcher Biometric Technology to Detect and Prevent Duplicate Registrations 3Einstein researchers develop technique to count messages made by single genes 2Birchwood Laboratories Expands B SURE 26amp 3B 238482 3B Incontinence and Personal Care Product Line 26amp 3B 238482 3B 3B Three New Products Added In 22889 1Birchwood Laboratories Expands B SURE 26amp 3B 238482 3B Incontinence and Personal Care Product Line 26amp 3B 238482 3B 3B Three New Products Added In 22889 2The 21st century tomato 3806 1The 21st century tomato 3806 2The 21st century tomato 3806 32008 ASABE Annual International Meeting 3804 12008 ASABE Annual International Meeting 3804 2International Team Locates Key Player in Muscle Regeneration 2537 1International Team Locates Key Player in Muscle Regeneration 2537 2
Other Contentschordateschordatejumpingjumpingjumpingjumpingwalkwalkwalkwalkwalkwalkwalkwalkchymecircularcircularcircularcircularcircularcircularcircularcircularcirculatorycirculatorycirculatorycirculatorycirculatorycirculatory