Navigation Links


Thalamus in Medical News

Siblings of schizophrenia patients display subtle shape abnormalities in brain

... in brain anatomy. "We're interested in the thalamus because it has a lot of connections to the ... are believed to involve the cortex, and since the thalamus projects throughout the cortex, it's conceivable abnormalities in the thalamus may be related to those symptoms." Since ...

Cocaine's effects on brain metabolism may contribute to abuse

... had significantly higher metabolism in the thalamus and cerebellum compared with normal mice. This ... also observed a reduction in metabolism in the thalamus region in the DAT knockout mice. This effect may ... These results also support the idea that the thalamus and the cerebellum play key roles in cocaine's ...

Research at Rice may help explain aspects of synesthesia

... . The ventrolateral nucleus (VL) of the thalamus is connected to the cerebellum and motor cortex ... due to even further weakened pathways between the thalamus and cortex, a finding which was also suggested by ... the results suggest that connections between the thalamus and other brain areas may be important for the ...

Study Offers Insights Into Sensory Perceptions

... from the eyes, ears or skin go through into the thalamus before they project onto higher areas of the ... only the ventrolateral nucleus, a part of the thalamus that is smaller than a pea, Ro said. She's now ... one case, the study "forces rethinking of how the thalamus and brain are organized," Cytowic said. "The ...

Area deep within the brain found to play role in sensory perception

... The ventrolateral nucleus (VL) of the thalamus is connected to the cerebellum and motor cortex ... due to even further weakened pathways between the thalamus and cortex, a finding which was also suggested by ... the results suggest that connections between the thalamus and other brain areas may be important for the ...

How to build a bigger brain

... volumes of the hippocampus and areas within the orbito-frontal cortex, the thalamus and the inferior temporal gyrus all regions known for regulating ... and increased gray matter in the right orbito-frontal cortex, the right thalamus and the left inferior temporal lobe. There were no regions where controls ...

Scripps Florida scientists devise accelerated method to determine infectious prion strains

... mouse line called Tga20 plays an important role, because it succumbs rapidly to prion disease. "The prions primarily target the brainstem and the thalamus of this transgenic mouse, explaining why these animals have a shorter incubation time than their normal counterparts," Lasmzas said. "The prion ...

Wayne State University and Children's Hospital of Michigan Research Team Discover Chemical That Plays a Major Role in Pediatric Obsessive-Compulsive Disorder

... significant associations between glutamate receptor and transporter genes and abnormal brain volumes in brain regions implicated in OCD such as the thalamus ('grand central station' in the brain), caudate nucleus (brain's secretary), anterior cingulate cortex (brain's arousal center) and orbital ...

Gulf War Syndrome May Stem From Chemical Exposure

... areas we previously suspected responded abnormally to the cholinergic challenge," Haley said. "Those areas were in the basal ganglia, hippocampus, thalamus and the amygdala. "Changes in functioning of these brain structures can certainly cause problems with concentration and memory, body pain, ...

Audience Selected as One of Two Finalists for Most Innovative True Mobile Start-Up for the '2008 GSMA Mobile Innovation Global Awards'

... accurate auditory system, the human hearing system. By thoroughly understanding the entire audio pathway -- from the cochlea to the brainstem to the thalamus and cortex -- Audience is the first company to deliver a commercial product based on the science of Auditory Scene Analysis (ASA), or the grouping ...

More>>

Thalamus in Biological News

'Cross fire' from the brain makes patients tremble

... feedback" and the frequency in a specific core region of the brain, in the thalamus and the basal ganglia, were not completely synchronous. With a ... the limbs is a fast and easy stimulus transmission. The signals from the thalamus and the basal ganglia are, however, transmitted to certain loop-like ...

Researchers discover that gene switches on during development of epilepsy

... While the hippocampus is usually targeted in studies of epilepsy, the new channels were being made in a region of the brain called the thalamus. The thalamus is connected to the hippocampus and is involved in the spread of seizures throughout the brain. "Certain kinds of channels are normal and expected ...

Audience Selected as Silver Winner in This Year's Wall Street Journal Technology Innovation Awards and Winner of the Semiconductors Category

... Innovation Awards and the winner of the Semiconductors category. By understanding the auditory pathway -- from the cochlea to the brainstem to the thalamus and cortex -- Audience is the first company to deliver a commercial product based on the science of Auditory Scene Analysis (ASA), or the grouping ...

Out of sight, out of mind? Not necessarily

... being processed unconsciously." Because only a certain region of the thalamus - the area of the brain where all sensory information is relayed -- can ... evidence that there must be a pathway that goes through this region of the thalamus to the higher visual centers of the brain, Ro said. "In addition to ...

Face perception is modulated by sexual orientation

... gender of a viewed individual, when the sexual preference of the viewer was taken into account, did make a difference in the reactions seen in the thalamus and the orbitofrontal cortex, a region of the brain's reward circuitry. Heterosexual women and homosexual men exhibited a significantly greater ...

What can change in the brain? Electrical synapses, research shows

... Landisman and Connors used in their experiments came from the thalamic reticular nucleus, a thin sheet of neurons that is part of the thalamus. The thalamus is a small region in the center of the brain responsible for relaying sensory information to the cerebral cortex, where it is transformed into ...
Thalamus in Biological Technology

RNArticles: Keeping RNA Intact Prior to RNA Isolation - RNAlater

... however, was expressed in both arcuate and thalamus at a similar level. For more ... 1. Comparing Rat Arcuate and thalamus Gene Expression Patterns. Real time RT-PCR of each of the two samples (arcuate and thalamus RNA) was performed for 40 cycles for both ...

SUPERIOR RNA FOR DEMANDING APPLICATIONS

... Size 6762 Human thalamus Total RNA 10 g 6810 ...

Human Universal cDNA Library Array I

... Brain: Subthalamic Nucleus Prostate Uterus Brain: thalamus Skeletal Muscle The total RNAs were obtained by a modified guanidium thiocyanate method, 2 and ...
Thalamus in Biological Definition

Brain

... epithalamus pineal gland thalamus hypothalamus pituitary gland ... pathways of vertebrates are routed to the thalamus and then to regions of the cerebral cortex that ... functions as well, especially those of the thalamus and hippocampus . Among vertebrates, sensory ...

Limbic system

... limbic system affects the endocrine system and the autonomic nervous system . It consists of several subcortical structures located around the thalamus : hippocampus : involved in the formation of long-term memory amygdala : involved in aggression and fear cingulate gyrus (the ...
Thalamus in Biological Dictionary

Thalamus

... The thalamus is a midline paired symmetrical structure within ... terms of its location and its ... thalamus n. , pl. -mi ( ). Anatomy. A large ovoid mass of ... the forebrain that relays sensory impulses thalamus Brain: ...

More>>

Other Contentschloroplastschloroplastschordateschordatejumpingjumpingjumpingjumpingwalkwalkwalkwalkwalkwalkwalkwalkchyme
(Date:11/29/2009)...via,s Nanjing-based Service Delivery Center one of... Brno, Czech Republic (PRWEB) -- Mor...rovider, is pleased to announce its participation ...ld in Nanjing, China, on November 30, 2009. Moravi...panies that have established and grown a presence ...
(Date:11/29/2009)... Nov. 29 Acuo Technologies, develo...software, data migration tools and services, today... that allows image sharing across the networks of ...oShare solution is based on the versatile Acuo Tec...cuo AcuoShare enables secure access from various P...
(Date:11/29/2009)...itional healthcare,s uncertain future and rising c...ve care. Affordable Acupuncture Scottsdale answers...mber 29, 2009 -- Affordable Acupuncture, LLC opene...s been met with enthusiasm and gratitude. Its incr...ted to two things, need and cost. "As far as...
(Date:11/28/2009)...t spirits, recognize signs of depression , ...y seniors, the holiday season can trigger melancho...ith health issues or worry about money problems, a...To help overcome the seasonal blues, the AGS Found...ice: , Get out and socialize or invite family an...
(Date:11/27/2009)... 27 The Gymboree Corpora..., CFO/COO, will present at the NASDAQ OMX 23rd Inv...Hotel in London, England, on Wednesday, December 2...ve broadcast of The Gymboree Corporation,s present...oree.com, click on "Our Company" at the bottom of ...
Breaking Medicine News(10 mins):Health News:Moravia Worldwide to Participate in the 5th EU-China Business Summit 2009 in Nanjing China 2Health News:Acuo Technologies Announces a New Offering That Enables Sharing of Imaging Studies Securely and Affordably 2Health News:Affordable Acupuncture Greeted with Open Arms by Scottsdale and Phoenix Communities 2Health News:Seniors May Need Help Overcoming Holiday Blues 2
(Date:11/24/2009)...4, 2009) New research on bacterial communities th... predictable temporal patterns, suggesting that sc...r monitoring climate change in the polar regions. ... of the National Academy of Sciences Early Editio...ers shifted synchronously over time, correlating w...
(Date:11/23/2009)...sents strong evidence that the "synergistic" effec...elated pollution and indoor endotoxin causes more ...osure alone. , Environmental health scientists...edicine have shown that children exposed to both h... endotoxin during early life are six times more li...
(Date:11/23/2009)...mber 23, 2009 Applied mathematicians dissected th...ia ), a characteristic long leaf with a saddle-lik...the edges. The simple cause of the lily,s fan-like...ring differential growthwas revealed by using an e..., Haiyi Liang, a postdoctoral student at Harvard...
Breaking Biology News(10 mins):Researchers establish common seasonal pattern among bacterial communities in Arctic rivers 2Exposure to both traffic, indoor pollutants puts some kids at higher risk for asthma later 2The cause behind the characteristic shape of a long leaf revealed 2Health Care Training a Great Option for Back to School Career Seekers 56327 1Health Care Training a Great Option for Back to School Career Seekers 56327 2Pew Commissioned Poll Finds Nine in Ten Iowa Voters Support More Government Oversight of Food 56323 1Pew Commissioned Poll Finds Nine in Ten Iowa Voters Support More Government Oversight of Food 56323 2Pew Commissioned Poll Finds Nine in Ten Iowa Voters Support More Government Oversight of Food 56323 3Hissey Kientz LLP Urges Patients To Heed FDA Warning About Phospho soda Products 56320 1Hissey Kientz LLP Urges Patients To Heed FDA Warning About Phospho soda Products 56320 2Hissey Kientz LLP Urges Patients To Heed FDA Warning About Phospho soda Products 56320 3Hissey Kientz LLP Urges Patients To Heed FDA Warning About Phospho soda Products 56320 4
Other TagsAdapterAdrenalAerobicAerobicOther Tagsteacher 2teacher 3dried 2dried 3fruits 2prolong 2