Sputum
Navigation Links
Sputum in Medical News
Diagnostic tools and innovative therapies improve patient prognosis
... current or former smokers with an abnormal sputum cytology, at least a 20-year history of smoking a ... DEVICE (LUCED): EARLY DETECTION OF LUNG CANCER IN sputum BASED ON 3D MORPHOLOGY (ABSTRACT # D1.3) Lung ... lesions. It has been known for decades that sputum (phlegm) from lung cancer patients frequently ...New antibiotic drug combo to speed up treatment of tuberculosis
... After two months of combination therapy, cultured sputum samples from patients taking moxifloxacin were ... The time to clear the infectious organism from sputum was also significantly shorter in the ... of therapy with moxifloxacin, 21 percent of the sputum samples were negative and cleared of visible ...PARI Pharma Completes Successful Clinical Trials for Tobramycin 100 & Investigational eFlow for CF
... for systemic and inhaled tobramycin applications, and both tobramycin sputum concentrations and the adverse reaction rates were similar. It appears ... thresholds for systemic and inhaled tobramycin applications. Tobramycin sputum concentrations were similar and the adverse reaction rate after 28 days of ...New technique detects specific chromosomal damage, may indicate lung cancer risk
... detect genetic changes in interphase cells, which are readily available in sputum samples. Whereas SKY is not a practical tool to directly apply to ... sequences that could improve the sensitivity of a FISH probe set for sputum screening and risk assessment, wrote Dr. Franklin. Improvement in ...Rare sheep could be key to better diagnostic tests in developing world, says Stanford study
... donors for the microbiology tests necessary to diagnose infectious disease in the developing world. Identifying microbes from a patient's urine or sputum requires growing those microbes in culture dishes filled with gelatinous agar and a small amount of blood. The blood provides nutrients to the ...Measurements fail to identify TB patients who could benefit from shorter treatment course
... two measurements were absence of a cavity (an abscess caused by TB) in the lungs (detected by chest X-ray) and failure to grow TB bacteria from the sputum once drug treatment was started (sputum culture conversion). The Phase III clinical trial involved TB patients in Uganda (Africa), Brazil (S. ...Sputum in Medical Technology
BioView Reports Interim Results of Early Detection Lung Cancer Diagnostic Test
... of lung cancer. In the trial a total of 76 sputum samples were collected from four groups of ... 1) 4. Advanced stage lung cancer patients The sputum samples were blindly scanned and analyzed ... in based on morphological and genetic analysis of sputum samples and it is running on BioView DUETTM ...NicOx Announces TOPIGEN Initiates Phase 2 Proof of Concept Study in COPD for TPI 1020
... of TPI 1020 and budesonide on the change in sputum neutrophil counts between baseline and day 42 and ... as efficacy of TPI 1020 versus budesonide on sputum neutrophils counts. Neutrophils are inflammatory ... endpoint will also measure the change in sputum neutrophil counts between baseline and day 21. ...... is needed." Currently, the most common testing method for TB is sputum microscopy , or the smear test, that has remained largely unchanged in ... method to identify tuberculosis, but it is much more sensitive." sputum microscopy, which often delivers poor sensitivity in patients suffering ...
Nanoemulsion Kills Highly Resistant Bacteria Found in Patients With Cystic Fibrosis
... with sufficient strength to subdue the bacteria or to penetrate the thick sputum and bacterial biofilms that coat the bacteria. The rising prevalence of ... also demonstrated bactericidal activity in the presence of cystic fibrosis sputum and against bacterial biofilms, protective coatings that surround ...Mpex Pharmaceuticals Presents New Data on MP-376 in Cystic Fibrosis
... thickened mucous layers -- Reduced antibacterial activity in CF sputum -- Inconvenient dosing regimens that reduce patient compliance ... -- Activity in CF sputum: Studies of antibiotic activity in CF sputum showed that levofloxacin retained its full antibacterial activity ...... to cut risks, particularly exposure to tobacco smoke. The most common symptoms of COPD are breathlessness (or a "need for air"), abnormal sputum (a mix of saliva and mucus in the airway), and a chronic cough. Daily activities, such as walking up a short flight of stairs or carrying a suitcase, ...
Sputum in Medical Products
Misty Ox™ Gas Injection Nebulizer (GIN BABY)™
Description:... concentration delivery. Heated Aerosol Therapy. Use the optional TurboHeater for airway hydration, mobilization of thick secretions, induced sputum or for rewarming hypothermic patients in the emergency department, post-operative anesthesia care units and neonatal intensive care ....Company:Vital Signs, Inc.
Description:... These unique Acid Fast Control Slides simulate a clinical sputum smear with appropriate background material. Slides have two wells containing a positive and negative smear. Can be used with Kinyoun (Cat. No. 353), ...
Company:Scientific Device Laboratory
Description:... Each slide contains an A.F.B. positive staining control of Mycobacterium scrofulaceum ATCC ® 19981 in simulated sputum and an A.F.B. negative staining control of Escherichia coli ATCC ® 25922 in simulated ....
Company:Alpha-Tec Systems
Description:... Slides contain two wells: a positive control containing Nocardia asteroides ATCC ® 3308 in simulated sputum and a negative control containing Streptomyces albus subsp. albus ATCC ® 3004 in simulated sputum. Nocardia Stain Control Slides should be ...
Company:Alpha-Tec Systems
Sterile Coil Packed Pediatric Suction Catheters with SAFE-T-VAC Valve
Features:... TOUCH-TROL reverse angle valve helps minimize the chance of contact with aspirated sputum PLASTIC GLIDE finish to minimize friction and facilitate secretion removal SAFE-T-VAC valves utilize Whistle tip for adult sizes (10-18Fr) and ...Company:Kendall Company
Sterile Straight Packed Pediatric Suction Catheters with SAFE-T-VAC Valve
Features:... TOUCH-TROL reverse angle valve helps minimize the chance of contact with aspirated sputum PLASTIC GLIDE finish to minimize friction and facilitate secretion removal SAFE-T-VAC valves utilize Whistle tip for adult sizes (10-18Fr) and ...Company:Kendall Company
Sputum in Medical Dictionary
... . eosinophil ia in the patient's blood and sputum . bronchiectasis A chronic enlargement of ... BRONCHIECTASIS SYMPTOMS" Chronic cough with sputum . He may cough up blood or blood stained sputum and have inflammation of the lungs . In ...
... Lung scan Pulmonary function tests sputum analysis (if the cough produces sputum ) X-ray of the chest ... During bronchoscopy or collection of a sputum sample using a catheter , you may feel a strong ...
... Frequent colds Cough ing up a lot of sputum Blood y sputum Achy, non-localized chest pain Fatigue ... blue tongue and lips, clenched teeth , frothy sputum , weak pulse , slow or absent breath, and coma ....
... (How much, how often) Do you bring up any mucus/ sputum when you cough ? What does it look like? Is it thick and hard to cough up? How much sputum is produced per day? Is the cough severe? Is ... who develop persi stent cough , blood y sputum ( coughing up blood ), shortness of breath, ...
... cytology exam of urine cytology exam of sputum Pap smear ... Nasal cytology (nasal ... way to diagnose the tumor type is with sputum cytology , in which mucus from the lungs ( sputum ) is examined under a microscope to check for ...
... sputum Gram stain Definition: Gram stain is a method ... a special series of stains. In this test, a sputum specimen is examined under the microscope. sputum Test See all Pictures & Images Why is the ...
... Lung scan Pulmonary function tests sputum analysis (if the cough produces sputum ) X-ray of the chest ... During bronchoscopy or collection of a sputum sample using a catheter , you may feel a strong ...
... Frequent colds Cough ing up a lot of sputum Blood y sputum Achy, non-localized chest pain Fatigue ... blue tongue and lips, clenched teeth , frothy sputum , weak pulse , slow or absent breath, and coma ....
... (How much, how often) Do you bring up any mucus/ sputum when you cough ? What does it look like? Is it thick and hard to cough up? How much sputum is produced per day? Is the cough severe? Is ... who develop persi stent cough , blood y sputum ( coughing up blood ), shortness of breath, ...
... cytology exam of urine cytology exam of sputum Pap smear ... Nasal cytology (nasal ... way to diagnose the tumor type is with sputum cytology , in which mucus from the lungs ( sputum ) is examined under a microscope to check for ...
... sputum Gram stain Definition: Gram stain is a method ... a special series of stains. In this test, a sputum specimen is examined under the microscope. sputum Test See all Pictures & Images Why is the ...
Sputum in Biological News
Nanoemulsion potent against superbugs that kill cystic fibrosis patients
... in the lungs: biofilms that bacteria form around them, and thick sputum present in the lungs of patients with cystic fibrosis. Research ... in a patient's body. Antibiotics often can't penetrate biofilms and sputum unless given at high doses with unacceptable side effects. "We saw, not ...American Chemical Society's Weekly PressPac -- Dec. 3, 2008
... of the first potential "biomarker" that could be used in development of a sputum test for early detection of chronic obstructive pulmonary disease (COPD). ... levels of SP-A. The scientists also found elevated levels of SP-A in the sputum samples of COPD patients. "This suggests that SP-A might represent a ...Space technology harnessed to search out TB
... in resource-poor settings relies mainly on the use of smear microscopy of sputum samples, a very labour-intensive process with low sensitivity. Now, ... adapt Rosetta's technology to develop a GC-MS capable of detecting TB in sputum with greater sensitivity than smear microscopy and significantly quicker ...Study finds environmental tests help predict hospital-acquired Legionnaires' disease risk
... period. When cases of Legionnaires were identified, patient urine and sputum samples from 12 of the hospitals were tested to determine classification ... among the 633 patients with hospital-acquired pneumonia whose urine or sputum samples were tested for Legionella bacteria. All were traced to hospitals ...In lung cancer, silencing one crucial gene disrupts normal functioning of genome
... findings contribute to the basic understanding of lung cancer development, they may also be useful in designing a "methylation signature" blood or sputum biomarker test to identify individuals who are at risk of developing the disease, the researchers say. "That may prove particularly beneficial in ...HIV/AIDS linked to extensively drug resistant TB
... resistant (MDR) tuberculosis and extensively drug-resistant (XDR) tuberculosis in a hospital in KwaZulu Natal. Between January 2005 and March 2006, sputum samples from 1,539 patients were screened. MDR TB was found in 221 patients and of those, 53 had XDR TB. Those patients with XDR who were tested for ...Sputum in Biological Technology
...
Xpert MTB/RIF not only detects the presence of TB organism directly from sputum in less than two hours, but also identifies whether the strain is ... detection of Mycobacterium tuberculosis and rifampicin-resistance from sputum samples with an easy-to-use PCR test system with near-patient capability ...
... Africa and Southeast Asia due to the close connection between HIV and TB. sputum microscopy, which often delivers poor sensitivity in patients suffering ... needed." Currently, the most common testing method for TB is the sputum microscopy, or smear test, that has remained largely unchanged in its ...
... Published literature suggests that reduction of eosinophils in sputum was associated with better asthma control and increases in sputum eosinophilia were associated with exacerbations of asthma. The antibody is ...
... Africa and Southeast Asia due to the close connection between HIV and TB. sputum microscopy, which often delivers poor sensitivity in patients suffering ... needed." Currently, the most common testing method for TB is the sputum microscopy, or smear test, that has remained largely unchanged in its ...
... Published literature suggests that reduction of eosinophils in sputum was associated with better asthma control and increases in sputum eosinophilia were associated with exacerbations of asthma. The antibody is ...
Biomoda and Medical Acoustics Partner in Study for Early Detection of Lung Cancer in Veterans
... to provide cost-efficient, easy to use method of collecting lung sputum samples for testing ALBUQUERQUE, N.M., Feb. 13 /PRNewswire-FirstCall/ -- ... Lung Flute(R) presents a safe, effective, convenient and rapid method of sputum induction for patients participating in our veterans' clinical study for ...Revotar Reports First Positive Clinical Results From Phase IIa Study in COPD
... short treatment period we were surprised to see that analysis of induced sputum prior to and after Bimosiamose treatment of 9 days showed that both relative and absolute lymphocytes count decreased significantly. In addition, sputum IL-8 was significantly decreased. The latter is supposed to correlate with ...Phase 3 Cystic Fibrosis Trial Results Presented at European Conference
... of the lung, pulmonary exacerbations and antibiotic use. Safety evaluation included the incidence of adverse events and the microbiology of sputum samples. Clinical Results -- There was a clinically meaningful change from baseline (119mL) and placebo (93mL) at week 26 with ...Sputum in Biological Products
Stat-Pack Sputolysin Reagent from Caldon Biotech, Inc.
Description:... concentration of Dithiothreitol (DTT) solution in phosphate buffer (pH 7.0). Dilute contents in one vial (10- fold) to 100 ml. For use in liquefying sputum ....Company:Caldon Biotech, Inc.
Angle Rotor with 323 Sealed Buckets, 4 50 ml from Thermo Scientific
Description:... 45° Fixed Angle Rotor for use in the IEC Centra CL2, Centra CL3CL3R, and Centra-MP4/MP4R. Perfect for rapid concentration of sputum samples and other difficult to separate infectious samples. Provides individual aerosol containment. Complete with rotor and 4 sealed ....Company:Thermo Scientific
Sputum in Biological Dictionary
... Care Policy and Research - AHCPR), 12 ... sputum cytology examines a sample of sputum (mucus) under a microscope to ... sputum cytology may be done to help detect certain ...
... WHO/FAO Workshop on Foodborne Trematode Infections in Asia, which was held ... trematode eggs frequently cannot be detected in the stools or sputum of ... Advances in Trematode Biology. Bernard Fried. CRC Press ... Advances in Trematode Biology presents a thorough treatment of modern ... ...
... WHO/FAO Workshop on Foodborne Trematode Infections in Asia, which was held ... trematode eggs frequently cannot be detected in the stools or sputum of ... Advances in Trematode Biology. Bernard Fried. CRC Press ... Advances in Trematode Biology presents a thorough treatment of modern ... ...
Other ContentsguideguideguideguideguideguideguideguideguidefracturesfracturesfracturesfracturesfoodsfoodsfoodsfoodsfoodsfoodsforeskinforeskinfungalfungalfungalfungalfungalfungalfungalfragilefragilefragilefragilefragileOther TagsMultilabelIRMAIRMA
(Date:11/25/2009)... of trouble with the H1N1 vaccine, , , ... H1N1 swine flu pandemic may be driving a recent s...s, a U.S. health official said Wednesday. , "We...fections around the country," Dr. Anne Schuchat, d...d Respiratory Diseases at the U.S. Centers for Dis...
(Date:11/25/2009)...also can reverse a rare stomach disorder and shoul..., researchers at Vanderbilt University Medical Cen...thickening of the stomach lining, severe abdominal...swelling in the feet and ankles due to protein los...er. Previously, the only effective treatment was g...
(Date:11/25/2009)...nds to include cost-effective, sustainable distanc...professionals in developing world. , ...09 -- Elluminate, Inc. , the leader in web, audi...port 21st century teaching, learning, and collabor...tiative was awarded iNACOL,s first-ever Outstandi...
(Date:11/25/2009)...dazzlesmile,llc www.dazzlesmile.com andOptimalHeal...eda67-pagefederallawsuitagainstEpicAdvertisingAKAA...vicesLimited,andAtLastFulfillment.The13-countCompl...strictofUtah,allegesmassivenationalconsumerfraud,c...gproducts,violationsoftheRacketeeringInfluencedand...
(Date:11/25/2009)...and Spanish . , , Researchers from the U...osis of certain ocular diseases that are very comm... and keratitis, by applying an existing optical te...used for this purpose. , Scientists from the UG...cted by one of these two pathologies, finding a gr...
Breaking Medicine News(10 mins):Health News:Swine Flu Tied to Rise in Pneumonias Among Young 2Health News:Swine Flu Tied to Rise in Pneumonias Among Young 3Health News:Swine Flu Tied to Rise in Pneumonias Among Young 4Health News:Vanderbilt scientists report first effective medical therapy for rare stomach disorder 2Health News:Elluminate's Fire and Ice Project Recognized as First-Ever iNACOL Award Winner for Outstanding and Most Innovative Online Learning Practice 2Health News:Elluminate's Fire and Ice Project Recognized as First-Ever iNACOL Award Winner for Outstanding and Most Innovative Online Learning Practice 3Health News:Elluminate's Fire and Ice Project Recognized as First-Ever iNACOL Award Winner for Outstanding and Most Innovative Online Learning Practice 4Health News:Elluminate's Fire and Ice Project Recognized as First-Ever iNACOL Award Winner for Outstanding and Most Innovative Online Learning Practice 5Health News:dazzlesmile Sues Epic Advertising and Jesse Willms 2Health News:Achieve early diagnosis of ocular pathologies such as keratitis and macular degeneration 2[0] Swine Flu Tied to Rise in Pneumonias Among Young[0] Vanderbilt scientists report first effective medical therapy for rare stomach disorder[0] Elluminate's Fire and Ice Project Recognized as First-Ever iNACOL Award Winner for Outstanding and Most Innovative Online Learning Practice[0] dazzlesmile Sues Epic Advertising and Jesse Willms[0] Achieve early diagnosis of ocular pathologies such as keratitis and macular degeneration
(Date:11/24/2009)... long held secrets of the earth,s history locked i...en very little information on the environments tha...ns of years. Now, a team of researchers from nine ...he tune of $10 million dollars by the National Sci...hings literally. These scientists will drill thro...
(Date:11/24/2009)...2009) New research on bacterial communities throu...edictable temporal patterns, suggesting that scien...onitoring climate change in the polar regions. The... the National Academy of Sciences Early Edition, ... shifted synchronously over time, correlating with...
(Date:11/23/2009)...ts strong evidence that the "synergistic" effect o...ted pollution and indoor endotoxin causes more har...re alone. , Environmental health scientists at...cine have shown that children exposed to both high...dotoxin during early life are six times more likel...
Breaking Biology News(10 mins):LSU gets to the bottom of things -- in Antarctica 2Researchers establish common seasonal pattern among bacterial communities in Arctic rivers 2Exposure to both traffic, indoor pollutants puts some kids at higher risk for asthma later 2Sorrento Therapeutics Inc and QuikByte Software Inc Complete Merger 14153 1Sorrento Therapeutics Inc and QuikByte Software Inc Complete Merger 14153 2Sorrento Therapeutics Inc and QuikByte Software Inc Complete Merger 14153 3Sorrento Therapeutics Inc and QuikByte Software Inc Complete Merger 14153 4NxStage Patient Takes Dialysis Machine on Third Annual Patient Good Will Tour 57690 1NxStage Patient Takes Dialysis Machine on Third Annual Patient Good Will Tour 57690 2NxStage Patient Takes Dialysis Machine on Third Annual Patient Good Will Tour 57690 3Sunesis Pharmaceuticals Receives NASDAQ Notification 14152 1Sunesis Pharmaceuticals Receives NASDAQ Notification 14152 2Sunesis Pharmaceuticals Receives NASDAQ Notification 14152 3DataMaxmultifilesspectrofluorometerFluoroLogpigmentsmultiwavelengthdisplaysclassifyingbathsgalvanizingpolarisationMultilabelAlphaQuestIRMA
Other Tagsherself 2herself 3herself 4herself 5parliament 2parliament 3elicit 2elicit 3ends 2ends 3ends 4ends 5introduction 2introduction 3introduction 4drops 2mortality 2mortality 3mortality 4mortality 5mortality 6mortality 7
| Copyright © 2003-2009 Bio-Medicine. All rights reserved. ABOUT | CONTACT US | DISCLAIMER | PRIVACY POLICY | TERMS AND CONDITIONS |  |