Specific
Navigation Links
Specific in Medical News
UC design research points the way so you won't get lost at the hospital
... representing any reading or education level to specific points in a hospital or other health-care ... symbol that would communicate and guide users to specific service areas: hospital admission, dental care, ... parts or elements possible to communicate a very specific message. We're always asking ourselves: Where can ...Celiac Disease Provides Clues To Solving Autoimmunity
... of neurological conditions. Malabsorption of specific nutrients may lead to such diverse conditions as ... immune reactions. Fasano has identified a specific protein, zonulin, involved in controlling the ... which is incubated with various foods to identify specific foods that trigger food intolerance. The solution ...SDSU's Process Improvement Programs Help Businesses Achieve Bottom Line Results
... 10 and consists of 13 class sessions. For specific dates, times, and fees, visit Lean Enterprise ... With Lean Six Sigma participants learn to create specific methods to eliminate defects and costs associated ... growth of 2-4 times industry average. For specific dates, times, and fees on the Lean Six Sigma ...... on the White House and federal agencies to make specific changes in the regulatory process to clearly ... regarding key science questions needed to write specific regulations. Federal Register notices for ... to have a limited number of closed meetings under specific circumstances. Transparency in the use of ...
... patients with SPLC have a 12% higher lung cancer specific mortality, Fox Chase Cancer Center researchers ... this second cancer on treatment and lung cancer specific mortality is unknown. With this study Li and her ... those with SPLC have a 12% higher lung cancer specific mortality. "Curing second primary lung cancers ...
WebMD Announces Second Quarter Financial Results
... those limitations, management also reviews the specific items that are excluded from Adjusted EBITDA, but ... Investors should pay close attention to the specific definition being used and to the reconciliation ... believes (i) the amount of such expenses in any specific period may not directly correlate to the ...Specific in Medical Technology
Researchers Create First Targeted Knockout Rats Using Zinc Finger Nuclease Technology
... viable technique for 'knocking out,' or mutating, specific genes to understand their function," said Howard ... proteins that induce double strand breaks at specific sites in an organism's DNA. Such double-strand ... Previously, ZFNs were used to knock out specific genes in fruit flies, worms, cultured human cells ...... Its actions can be followed by induction of a specific DNA binding protein foci that can be detected in ... data provide important further insights into the specific bio-marker (tumor glutathione levels) that ... and regulatory expertise to find and exploit a specific cancer's 'context of vulnerability.' ...
ADHD Genes Found; Known to Play Roles in Neurodevelopment
... may interact to raise an individual's risk for a specific disease. "When we began this study in 2003, we ... However, as researchers learn more about specific genes in neurological conditions, the hope is ... own genetic profile, to achieve more targeted, specific therapies. Elia and White stressed that much ...... chemokine receptor represents a new and highly specific approach to treating patients with Crohn's ... chemokine receptor. In adults, CCR9 is a highly specific receptor expressed by T cells that migrate ... ChemoCentryx's lead compound, Traficet-EN, a specific CCR9 antagonist, is in a Phase II/III ...
New Study Shows Probiotic Strain Effective in Boosting Immune Response to Flu Virus
... issue of Postgraduate Medicine suggests that a specific strain of probiotics , Bacillus coagulans ... believe that probiotics can help people who have specific health conditions, there has been controversy ... Sustenex , a dietary supplement containing the specific Bacillus coagulans GBI-30, PTA-6086 probiotic ...Investigational Genetic Test May Help Address Common Problems in Prostate Cancer Diagnosis
... GPRO ) investigational test for the highly specific prostate cancer gene PCA3 may help address some ... Studies have shown that because PCA3 is highly specific for prostate cancer, it predicts the results of ... to total prostate volume or serum Prostate specific Antigen." Felix K h Chun, et al. (3) AUA ...Specific in Medical Products
MGB Alert Norovirus 1 & 2 ASR*
Description:... tools for detecting nucleic acid sequences of specific organisms or genetic mutations associated with ... technologies. MGB Alert Detection Reagents for specific analytes can be optimized for use with universal ... reagents to create homebrew tests. *Analyte specific Reagents. Analytical and performance ...Company:Nanogen, Inc.
Description:... tools for detecting nucleic acid sequences of specific organisms or genetic mutations associated with ... technologies. MGB Alert Detection Reagents for specific analytes can be optimized for use with universal ... sequence within the following: U67. *Analyte specific Reagents. Analytical and performance ...
Company:Nanogen, Inc.
MGB Alert Mycoplasma pneumoniae ASR*
Description:... tools for detecting nucleic acid sequences of specific organisms or genetic mutations associated with ... technologies. MGB Alert Detection Reagents for specific analytes can be optimized for use with universal ... to create homebrew tests. *Analyte specific Reagents. Analytical and performance ...Company:Nanogen, Inc.
Description:... tools for detecting nucleic acid sequences of specific organisms or genetic mutations associated with ... technologies. MGB Alert Detection Reagents for specific analytes can be optimized for use with universal ... single primer and probe mix. *Analyte specific Reagents. Analytical and performance ...
Company:Nanogen, Inc.
MBG Alert HSV 1, 2 Ensemble ASR*
Description:... tools for detecting nucleic acid sequences of specific organisms or genetic mutations associated with ... technologies. MGB Alert Detection Reagents for specific analytes can be optimized for use with universal ... but does not differentiate. *Analyte specific Reagents. Analytical and performance ...Company:Nanogen, Inc.
Description:... tools for detecting nucleic acid sequences of specific organisms or genetic mutations associated with ... technologies. MGB Alert Detection Reagents for specific analytes can be optimized for use with universal ... sequence within the following: IE1 *Analyte specific Reagents. Analytical and performance ...
Company:Nanogen, Inc.
Specific in Medical Definition
Artificial induction of immunity
... based on this theory, which posited that specific microorganisms cause specific diseases, Pasteur isolated the infectious agent ... of immunity Temporary immunity to a specific infection can be induced in a subject by ...... event is generalized and the context of the specific events is lost. One modification of this view is ... in episodic memory performance Activation of specific brain areas (mostly the hippocampus ) seems to ... appear to remember the ‘what-where-and-when’ of specific caching events in the past. Clayton & ...
... framework with which to analyze and understand specific human diseases. Adaptation to injury ... and tissues may respond to injury and stress by specific mechanisms, which may vary accroding to the cell ... the injury. In the short term, cells may activate specific genetic programs to protect their vital proteins ...
... General appearance of the patient and specific indicators of disease (nutritional status, ... assays , and procedures needed for providing the specific services. Pathology is the branch of ... there are many pediatric subspecialities for specific age ranges, organ systems, disease classes, and ...
Depolarization-induced suppression of inhibition
... in rat somatosensory cortex: laminar differences and involvement of specific interneuron types. J Neurosci. Jul 20;25(29):6845-56. Carlson G, ... CB1 cannabinoid receptors regulate GABA release from axon terminals of specific hippocampal interneurons. J Neurosci. Jun 1;19(11):4544-58. Kreitzer ...... may include facilities for the preparation of radiopharmaceuticals. The specific name of a department can vary from hospital to hospital, with the most ... of source code to provide quantitative analysis packages for each of the specific imaging techniques available in nuclear medicine, Radiation dose ...
Specific in Medical Dictionary
... mal absorption can be the failure to absorb specific sugar s, fats, protein s, or vitamins , or it ... , gluten mal absorption , and intolerance to specific foods like beans or fruit. mal absorption ... northern South America, Asia, Africa, and other specific locations. mal absorption - Inherited ...
... art of acupuncture involves the stimulation of specific points on the body by a variety of ... of very fine sterile needles into the body at specific points according to a mapping of "energy ... of inserting thin needles through the skin at specific points on the body to control pain and other ...
... particles, like pollen or dust, by producing specific protein s called antibodies that are capable of ... . Allergy tests are used to determine the specific substances that cause an allergic reaction in an ... substitute for medical advice or treatment for specific medical conditions. Allergy : Insect Sting ...
... in susceptibility and resistance to disease . specific HLA antigen s influence the development of many ... , a substance perceived as a threat (usually a specific antigen found in a particular food ) binds to ... called a PSA test, that stands for prostate specific antigen , which is a blood test. And in ...
... pain and the finding of tender points at specific locations by a physician . There are no blood ... : The determination of the presence of a specific disease or infection , usually accomplished by ... or the bladder so that an X-ray can be taken. specific diagnostic procedures include intravenous ...
... Enzyme markers are tests for specific enzyme activity in the body. Disease s can ... Enzyme s are complex protein s that cause a specific chemical change in other substances without being ... a particular biochemical reaction involving specific substrate (reactant) molecules. Virtually all ...
... art of acupuncture involves the stimulation of specific points on the body by a variety of ... of very fine sterile needles into the body at specific points according to a mapping of "energy ... of inserting thin needles through the skin at specific points on the body to control pain and other ...
... particles, like pollen or dust, by producing specific protein s called antibodies that are capable of ... . Allergy tests are used to determine the specific substances that cause an allergic reaction in an ... substitute for medical advice or treatment for specific medical conditions. Allergy : Insect Sting ...
... in susceptibility and resistance to disease . specific HLA antigen s influence the development of many ... , a substance perceived as a threat (usually a specific antigen found in a particular food ) binds to ... called a PSA test, that stands for prostate specific antigen , which is a blood test. And in ...
... pain and the finding of tender points at specific locations by a physician . There are no blood ... : The determination of the presence of a specific disease or infection , usually accomplished by ... or the bladder so that an X-ray can be taken. specific diagnostic procedures include intravenous ...
... Enzyme markers are tests for specific enzyme activity in the body. Disease s can ... Enzyme s are complex protein s that cause a specific chemical change in other substances without being ... a particular biochemical reaction involving specific substrate (reactant) molecules. Virtually all ...
Specific in Biological News
Researchers develop 'brain-reading' methods
... until now, there was little way to determine what specific mental tasks were taking place prior to the point ... localized areas of the brain are responsible for specific mental functions is misleading and incorrect. ... of the brain that are uniquely responsible for specific mental functions, such as learning, memory, fear ...Grant supports LSUHSC research on how like cell receptor systems determine very different functions
... in how the generic ERK signaling pathway confers specific physiological outcomes such as proliferation, ... in treating conditions that are dependent upon specific growth factor receptors, like some breast cancers ... "Our studies might provide insight into how specific functions of a pathway might be targeted ...Newly discovered gene fusion may lead to improved prostate cancer diagnosis
... gene fusions. "In the future, these fusions, specific to certain types of prostate cancer, may help ... is a first step toward providing patients with specific therapies that target individual cancer variants, ... findings will help doctors diagnose a patient's specific disease," explains Dr. Rubin. Novel Gene ...A global model for the origin of species independent of geographical isolation
... species. In the second, an environment favors specific characteristics within a species, which ... evidence that species diversity arises without specific physical barriers," the study states. The ... study. "While the spatial environment may vary, specific physical barriers aren't necessary. Just as ...LincRNAs serve as genetic air-traffic controllers
... ferrying proteins to assist their regulation at specific regions of the genome. "I like to think of ... chromatin structure is so precisely targeted by specific enzymes and not others. "By utilizing a ... proteins work together with lincRNAs to target specific regions of the genome." Standard "textbook" ...22nd Congress of the European College of Neuropsychopharmacology, Sept. 12-16, 2009, Turkey
... neurotransmitter systems. The discovery of specific receptors in the brain has led to the ... the goal of neuropsychopharmacology is to develop specific therapeutic agents to regulate the biological ... that are required to develop drugs, which act on specific receptors within a neurotransmitter system. The ...Specific in Biological Technology
OMT announces a breakthrough in the development of a novel human antibody platform
... demonstrate the ability to generate heritable, specific and permanent modifications in a mammal using ... proteins that induce double-strand breaks at specific sites in an organism's DNA. Such double-strand ... sequence. Up to now, ZFNs have been used to edit specific genes in fruit flies, worms (C. elegans), ...... of advanced preclinical platforms and tumor specific data to enhance the value of oncology drugs, has ... of advanced preclinical platforms and tumor specific data to enhance and accelerate the value of ... its predictive preclinical platform and tumor specific data to physicians for personalized patient care ...
MIT, BU engineer cellular circuits that count events
... in which a series of genes are activated in a specific order. Such circuits, which mimic those found ... designing small circuit components to accomplish specific tasks. "Our goal is to build simple design ... an enzyme known as invertase, which chops out a specific section of double-stranded DNA, flips it over and ...Osteotech Reports First Quarter 2009 Financial Results
... to learn about how Plexur P can be utilized in specific foot and ankle, trauma and joint revision ... to introduce biologics that can meet the needs of specific procedures and lead to better clinical outcomes. ... and educational programs focused on procedure specific applications for Plexur P and Grafton(R) DBM. ...CEL-SCI's L.E.A.P.S. Technology Shows Potential to Treat Swine Influenza in Preclinical Studies
... to the appropriate T lymphocyte and then deliver specific cytokine proteins to the T cell to determine the immune response outcome to the specific vaccine. Each L.E.A.P.S. construct is ... induce and elicit protective immunity and antigen specific antibody production in animal models. In ...... Count(TM) genomics technology, which examines specific regions in virus genes which have been linked ... then detected the highest concentrations of these specific regions ever seen, except for those from the 1918 ... been followed consistently by an outbreak of the specific strain. The current increase appears to ...
Specific in Biological Products
[14C] Methylated Protein Molecular Weight Markers from GE Healthcare, formerly Amersham Biosciences
Description:... of band migration in the gel and on the blot.The specific activity of the [14C] version without ... kBq/ml (5 uCi/ml), supplied in aqueous buffer.The specific activity of the Rainbow-labeled version is ... Protein Molecular Weight Markers and pI Markers. specific Shipment: USDA Animal ....Company:GE Healthcare, formerly Amersham Biosciences
Description:... assay designed to detect amplified nucleic acid specific to the target of interest. Amplification ... is captured to the plate via hybridization with a specific oligonucleotide probe immobilized to the reaction well (target specific probe-coated plate included in the XpressPack ...
Company:CHEMICON
Description:... assay designed to detect amplified nucleic acid specific to the target of interest. Amplification ... is captured to the plate via hybridization with a specific oligonucleotide probe immobilized to the reaction well (target specific probe-coated plate included in the ...
Company:CHEMICON
miRCURY LNA in situ Detection probes from Exiqon
Description:... miRCURY LNA technology enables sensitive and specific detection of microRNAs (miRNAs) by in situ ... binding affinity and discrimination, enabling the specific and sensitive detection of miRNAs. specific in situ detection of miRNA is possible in whole ...Company:Exiqon
MAXIscript SP6/T7 Kit from Ambion
Description:... Ambions MAXIscript In Vitro Transcription Kits synthesize RNA probes with specific activities reaching 1 x 10 9 cpm/g. High specific activity, single-stranded RNA probes are used in ribonuclease protection ...Company:Ambion
Senescence Colorimetric Assay Kit from BioVision
Description:... Designed to histochemically detect specific senescence marker in distinct pH in cultured cells and tissue sections. The specific marker is only present in senescent cells (not found in ...Company:BioVision
Specific in Biological Definition
...
1 General Procedure
2 specific Uses
3 Batch verses column
4 Affinity ... or used simply for analytical purposes.
specific Uses
Affinity chromatography can be used in a ... If serum is known to contain antibodies against a specific antigen (for example if the serum comes from an ...
... and viruses . Each antibody recognizes a specific antigen unique to its target. Contents ... B cells are activated upon binding to their specific antigen. In some cases the interaction of the B ... two variable domains bind the antigens they are specific for and that elicited their production. The ...
... then to regions of the cerebral cortex that are specific to each sensory system : the visual system , ... whether areas of the brain corresponded to specific functions or if the brain functioned as a whole ... helped show that areas of the brain had specific functions, though some functions were repeated, ...
... sweating ( night sweats ), anemia , and specific paraneoplastic phenomena , i.e. specific conditions that are due to an active cancer, such ... digital rectal exam along with annual prostate specific antigen blood testing. Screening for cancer is ...
... vapors are a general unspecific color reagent. specific color reagents exist into which the TLC plate is ... way to purify proteins . It is based on the specific coordinate covalent binding between histidine ... non-covalent interaction between an analyte and specific molecules. It is very specific, but not very ...
... evolution to explain differences between specific cultures -- an approach that either was a form ... understood in terms of his or her culture; that a specific cultural artifact (e.g. a ritual) had to be ... and "civilization" Kulturkampf — a specific cultural fight in 1870s Germany Organizational ...
... and viruses . Each antibody recognizes a specific antigen unique to its target. Contents ... B cells are activated upon binding to their specific antigen. In some cases the interaction of the B ... two variable domains bind the antigens they are specific for and that elicited their production. The ...
... then to regions of the cerebral cortex that are specific to each sensory system : the visual system , ... whether areas of the brain corresponded to specific functions or if the brain functioned as a whole ... helped show that areas of the brain had specific functions, though some functions were repeated, ...
... sweating ( night sweats ), anemia , and specific paraneoplastic phenomena , i.e. specific conditions that are due to an active cancer, such ... digital rectal exam along with annual prostate specific antigen blood testing. Screening for cancer is ...
... vapors are a general unspecific color reagent. specific color reagents exist into which the TLC plate is ... way to purify proteins . It is based on the specific coordinate covalent binding between histidine ... non-covalent interaction between an analyte and specific molecules. It is very specific, but not very ...
... evolution to explain differences between specific cultures -- an approach that either was a form ... understood in terms of his or her culture; that a specific cultural artifact (e.g. a ritual) had to be ... and "civilization" Kulturkampf — a specific cultural fight in 1870s Germany Organizational ...
Specific in Biological Dictionary
... factor is a protein that binds to specific DNA sequences and thereby controls the transfer ... THC ... Some transcription factors bind to specific sequences of DNA (promoters and ... ... ... Transcription factors are able to bind to specific sets of ... transcription factor complex. ...
... Site - specific recombination , also known as conservative site - specific recombination , is a type of genetic ... a limited degree of sequence homology. Site - specific recombinases ... Cre-Lox ...
... The condition in which a gene responsible for a specific trait ... Genes that are present on the X or Y ... - linked recessive" usually refers to the more specific ... ... Health Encyclopedia > Sex - linked ... - linked recessive" usually refers to the more specific ... Sex - linked dominant is a rare way ...
... acids (DNA/RNA). It does not, however, describe specific ... The functional form of single stranded RNA molecules frequently requires a specific tertiary structure . The scaffold for this ... structure elements are observed to combine in specific geometric ... look at motifs consisting of no ...
... discovery of RNA interference ... Potent and specific genetic interference by double-stranded RNA ... knowledge: RNAi is a post-transcriptional ... specific interference with gene function by ... human genome with RNA interference " ... specific genetic interference by double-stranded RNA ...
... cuts double-stranded or single stranded DNA at specific recognition nucleotide sequences known as ... enzymes that catalyze the cleavage of DNA at specific sites to produce discrete fragments, used ... than 900 restriction enzymes , some sequence specific and some not, ... These restriction enzymes ...
... Site - specific recombination , also known as conservative site - specific recombination , is a type of genetic ... a limited degree of sequence homology. Site - specific recombinases ... Cre-Lox ...
... The condition in which a gene responsible for a specific trait ... Genes that are present on the X or Y ... - linked recessive" usually refers to the more specific ... ... Health Encyclopedia > Sex - linked ... - linked recessive" usually refers to the more specific ... Sex - linked dominant is a rare way ...
... acids (DNA/RNA). It does not, however, describe specific ... The functional form of single stranded RNA molecules frequently requires a specific tertiary structure . The scaffold for this ... structure elements are observed to combine in specific geometric ... look at motifs consisting of no ...
... discovery of RNA interference ... Potent and specific genetic interference by double-stranded RNA ... knowledge: RNAi is a post-transcriptional ... specific interference with gene function by ... human genome with RNA interference " ... specific genetic interference by double-stranded RNA ...
... cuts double-stranded or single stranded DNA at specific recognition nucleotide sequences known as ... enzymes that catalyze the cleavage of DNA at specific sites to produce discrete fragments, used ... than 900 restriction enzymes , some sequence specific and some not, ... These restriction enzymes ...
Other Contentswartswartswaspwaspremovalremovalremovalremovalremovalremovalremovalremovalremovalremovalwartwartwaxwaxwaxwaxwaxwaterwaterwaterwaterwaterwaterwaterwaterwaterwaterweaknessweaknessweaknessweaknessweakness
Breaking Medicine News(10 mins):Health News:AdCare Health Systems Completes Private Placement to Fund Aggressive Growth Initiatives 2Health News:AdCare Health Systems Completes Private Placement to Fund Aggressive Growth Initiatives 3Health News:Rachel Alexandra, Kendall-Jackson Donate $20,000 to V Foundation for Cancer Research 2Health News:Vitamin D Linked to Survival in Lymphoma Patients 2Health News:States Slash Funding for Tobacco Prevention Programs 2Health News:States Slash Funding for Tobacco Prevention Programs 3Health News:Genetic Test May Someday Help Spot Breast Cancer 2Health News:Genetic Test May Someday Help Spot Breast Cancer 3
[1] AdCare Health Systems Completes Private Placement to Fund Aggressive Growth Initiatives[0] Rachel Alexandra, Kendall-Jackson Donate $20,000 to V Foundation for Cancer Research[0] Vitamin D Linked to Survival in Lymphoma Patients[0] States Slash Funding for Tobacco Prevention Programs[0] Genetic Test May Someday Help Spot Breast Cancer
Breaking Biology News(10 mins):MSU research may lead to new ways to control honeybee parasite 2Germany starts its part in the International Cancer Genome Project 2Germany starts its part in the International Cancer Genome Project 3Germany starts its part in the International Cancer Genome Project 4Study confirms association between tobacco smoke and behavioral problems in children 2LifeSpan Treadmill Awarded BEST TREADMILL by Health Magazine 52317 1LifeSpan Treadmill Awarded BEST TREADMILL by Health Magazine 52317 2Studies Affirm Value of Healthy Lifestyle 52315 1Studies Affirm Value of Healthy Lifestyle 52315 2Studies Affirm Value of Healthy Lifestyle 52315 3Michigan Chamber of Commerce Raises Concerns With Flawed Federal Health Care Reform Proposal Rushed Timeline 52310 1Michigan Chamber of Commerce Raises Concerns With Flawed Federal Health Care Reform Proposal Rushed Timeline 52310 2
Other TagsTopCountlanthanidephosphorimeterSpexSpectroscopyDataMaxmultifilesspectrofluorometerFluoroLogpigmentsmultiwavelengthdisplaysclassifyingbaths
Other Tagscapture 2capture 3capture 4soft 2soft 3soft 4state 2state 3state 4state 5state 6state 7state 8state 9state 10bug 2| Copyright © 2003-2009 Bio-Medicine. All rights reserved. ABOUT | CONTACT US | DISCLAIMER | PRIVACY POLICY | TERMS AND CONDITIONS |  |