Navigation Links


Edema in Medical News

Cancer treatment controls macular edema related to diabetes and to cataract surgery

... to benefit diabetic patients with macular edema as well as people who develop cystoid macular edema after cataract surgery. Bevacizumab is also used ... Patients; Treatment also Controls Cystoid Macular edema after Cataract Surgery DR damages the ...

Chemical can reproduce complications for some patients

... Protocol 3 was designed to measure edema formation, or the volume of water that has been ... as an index of tissue fluid retention and, thus, edema formation. The ratios for all individual organs ... group were pooled to create an overall index of edema formation. The pooled ratio for the CHX group ...

Drug May Not Help Diabetes-Related Eye Damage

... the development of blindness-causing macular edema in people with diabetes who have mild-to-moderate ... complications. Clinically significant macular edema (CSME) occurs when diabetic retinopathy ... laser treatment for those who develop macular edema or proliferative retinopathy reduces the rate of ...

Diabetes drug class linked to vision-threatening complication

... "modest" increase in the risk of diabetic macular edema (DME)a common complication that can lead to ... and the development of DME. Diabetic macular edema is a common diabetes complication, with swelling ... to problems related to fluid retention and edema (swelling), including heart failure. Fluid ...

Drug Improves Survival in Mice With Brain Tumors

... News) -- Anti-angiogenesis drugs reduce edema (swelling of brain tissue) caused by deadly brain ... anti-angiogenesis drug cediranib reduced edema and improved survival in mice with glioblastomas. ... or chemotherapy for glioblastoma, reducing edema and the size of tumors. But exactly how the drug ...

Angiogenesis inhibitor improves brain tumor survival by reducing edema

... appear to result primarily from reduction of edema the swelling of brain tissue and not from any ... with the experimental drug cediranib reduced edema and improved survival in three mouse models of ... surgery, radiation or chemotherapy reducing edema and apparently the size of the tumors. But the ...

More>>

Edema in Medical Technology

Neurobiological Technologies' Partner, Celtic Pharma, Announces Results of XERECEPT(R) Phase 3 Clinical Program

... Clinical Program for XERECEPT(R) in patients with edema associated with brain tumors and from preclinical ... of XERECEPT(R) in Patients with Cerebral edema Demonstrated Clinically Significant Reductions in ... standard of care in the treatment of cerebral edema associated with brain tumors, and an open-label ...

Video: Data on More Than 15 Novartis Oncology Compounds at ASCO Highlight Progress Toward Targeted Therapies for Diverse Tumor Types

... pulmonary edema, and ascites) and superficial edema (1.3%-11%), hemorrhage (1.8%-19%), and ... effusion or ascites; 3%; 8%) and superficial edema (6%; 5%), hemorrhage (6%; 11%), abdominal pain ... adverse reactions (all Grades) were superficial edema (60%-74%), nausea (50%-73%), muscle cramps ...

Bayer and Regeneron Extend Development Program for VEGF Trap-Eye to Include Central Retinal Vein Occlusion

... a Phase 2 study in patients with Diabetic Macular edema (DME). Enrollment in the wet AMD and DME studies ... the underlying biology of CRVO is related to edema and the growth of abnormal new blood vessels that ... may help decrease vascular permeability and edema and prevent the growth of abnormal new blood ...

More Than 200 Abstracts at ASH and SABCS Reveal Potential Compelling Patient Benefits From Novartis Oncology Current and Pipeline Therapies

... retention (e.g., pleural effusion, pulmonary edema and ascites) and superficial edema (1.3%-11%), hemorrhage (1.8%-19%) and ... adverse reactions (all Grades) were superficial edema (60%-74%), nausea (50%-73%), muscle cramps ...

Early Data Show Potential for Imatinib Mesylate Tablets to Treat Life-Threatening Form of Pulmonary Artery Disease

... or ascites; 3%; 8%) and superficial edema (6%; 5%), hemorrhage (6%; 11%), abdominal pain ... adverse reactions (all Grades) were superficial edema (60%-74%), nausea (50%-73%), muscle ... pain was less frequent (20.5%) and peripheral edema was not reported. Nausea and vomiting were the ...

DSMB Again Supports Continuation of the Phase III Clinical Trial of Medidur(TM) FA for the Treatment of DME

... Medidur FA for the treatment of diabetic macular edema (DME). FAME is two, duplicate, double-masked, ... years as a treatment for diabetic macular edema (DME). Using a proprietary 25 gauge injector ... diabetic retinopathy, of which diabetic macular edema is the primary cause of vision loss. In ...

More>>

Edema in Medical Products

SP Walker™

Description:... patient comfort while providing superior injury protection, support, and edema reduction. The Walkers low rocker sole promotes more natural ambulation ... for full limb contact and produce pneumatic compression for efficient edema reduction. Because of the SP Walkers adjustability, it can accommodate ...
Company:Aircast

Direct Image High-Mag SSV®

Description:... limiting membrane peeling in macular hole surgery, optic nerve neurotomy, sheathotomy and macularepiretinal membrane removal, traditional macular edema and other situations warranting higher magnification. This lens was developed with K.V. Chalam, ....
Company:Volk Optical, Inc.

Direct Image High-Mag

Description:... limiting membrane peeling in macular hole surgery, optic nerve neurotomy, sheathotomy and macularepiretinal membrane removal, traditional macular edema and other situations warranting higher ....
Company:Volk Optical, Inc.

Model 4420 Colloid Osmometer

Description:... Model 4420 Colloid Osmometer. Rapid measurement of colloid osmotic (oncotic) pressure for the prediction of edema onset in clinical situations. Uses a semi-permeable membrane dividing sample and reference chambers to simulate the role of the natural vascular ...
Company:Wescor, Inc.

Dale® Tracheostomy Tube Holder - Extension Piece

Description:... Dale® Tracheostomy Tube Holder incorporates a length of stretch material that allows for cough reflex. The stretch material also accommodates any edema around the neck, and ensures a safe, snug and comfortable fit. An extension piece is also available to accommodate your obese ....
Company:Dale Medical Products, Inc.

Dale® Tracheostomy Tube Holder - Neonatal to Infant

Description:... Dale® Tracheostomy Tube Holder incorporates a length of stretch material that allows for cough reflex. The stretch material also accommodates any edema around the neck, and ensures a safe, snug and comfortable fit. An extension piece is also available to accommodate your obese ....
Company:Dale Medical Products, Inc.

More>>

Edema in Medical Definition

Pathology

... prematurity - Macular degeneration - Retinitis pigmentosa - Macular edema - Epiretinal membrane - Macular pucker Ocular muscles , ... the interstitium Acute respiratory distress syndrome - Pulmonary edema - Hamman-Rich syndrome - Interstitial lung disease Suppurative ...

Somatic dysfunction

... with visceral illness. Similarly, the resolution of either can aid in the resolution of the other. For example, an infection may be associated with edema (causing a tissue texture change). Lymphatic drainage aids in clearing the infection while, conversely, resolution of the infection causes clearing ...

Space medicine

... body. When gravity is taken away or reduced during space exploration, the blood tends to collect in the upper body instead, resulting in facial edema and other unwelcome side effects. Upon return to earth, the blood begins to pool in the lower extremities again, resulting in orthostatic ...
Edema in Medical Dictionary

Albumin

... drop, fluid may collect in the ankles ( pedal edema ), lungs ( pulmonary edema ), or abdomen ( ascites ). Albumin in ... of the protein albumin into the urine ) and edema ( swelling ) of the hands, feet, and face. ...

Angioedema

... occur at the same time. Angioedema Angio- edema , Angio-o edema A vascular reaction involving the deep dermis ... vasodilation , superficial ( papilla ry) dermal edema , ... Angioedema is an allergic reaction ...

Ascites

... amounts of fluid to accumulate in your legs ( edema ) and abdominal cavity ( ascites ). edema is especially common in alcoholic cirrhosis . ... drop, fluid may collect in the ankles ( pedal edema ), lungs ( ...

Calcium

... loss; eddy sounds; edea; edeine; edelweiss; edema ; edema , cardiac ; edema tization; ...

Cartilage

... "Adam's apple" is part of the larynx . Laryngo edema Laryngeal edema , Laryngeal O edema ... A layer of smooth cartilage coats the ...

Edema

... edema Related Category: Pathology (d´m), ... or distention of the affected parts. edema Definition edema is a condition of abnormally large fluid volume ...

More>>

Edema in Biological News

OSU technologies funded for development

... of a 3D Human Tissue Model for Screening Potential Diabetic Macular edema Therapeutics, School of Chemical Engineering. With a current 3D human ... model, which will be used to screen potential diabetic macular edema therapeutics. Charlesson LLC, an Oklahoma-based company already engaged ...

Scientists present 'moving' theory behind bacterial decision-making

... regulators studied by the NC State biochemists, called AbrB, helps control the production of the three toxins in anthrax: lethal factor, edema factor and protective antigen. Production of all three of these toxins is necessary to make anthrax lethal. Cavanagh and Bobay say that knowledge ...

Opening a channel for salt retention

... ENaC. The sustained yet reversible action of S3969 makes it a good model to build future drugs aimed at improving hypotension, neonatal pulmonary edema (reduced sodium uptake in the lungs can lead to fluid retention), and renal salt wasting disorders. ...

Early exposure to common weed killer impairs amphibian development

... Twelve to 24 hours after exposure to atrazine, tadpoles were examined for abnormal heart growth, visceral hemorrhaging, intestinal coiling, edema and apoptosis (normal cell death that is "programmed" by the body). Compared with control populations, the tadpoles that were exposed to atrazine ...

The endocannabinoids: Functional roles and therapeutic opportunities

... that the endocannabinoid system, through various biological routes, lowers the damage caused by brain trauma. Thus, it helps to attenuate the brain edema and the neurological injuries caused by it (Panikashvili et al., 2001; Panikashvili et al., 2006). Clinical importance Furthermore it is ...

Study shows pine bark naturally decreases severe chronic venous insufficiency

... Pycnogenol® to be more effective in reducing edema (leg swelling), tight calves, skin alterations, ... Like varicose veins, spider veins also develop if edema is left untreated. "Chronic venous ... was recorded by patients. A second evaluation of edema was made by another physician. After eight ...

More>>

Edema in Biological Technology

Gleevec Receives FDA Priority Review as First Therapy to Reduce Recurrence of Gastrointestinal Stromal Tumors After Surgery

... edema, and ascites) and superficial edema (1.3%-11%), hemorrhage (1.8%-19%), and ... effusion or ascites; 3%; 8%) and superficial edema (6%; 5%), hemorrhage (6%; 11%), abdominal pain ... adverse reactions (all Grades) were superficial edema (60%-74%), nausea (50%-73%), muscle ...

ThromboGenics Presents Results of the Vitreomacular Traction Trial (MIVI IIT) at the American Society of Retina Specialists Annual Meeting

... These include macular hole, macular edema (ME) associated with vitreomacular traction, ... for microplasmin include treatment of macular edema and diabetic retinopathy. Diabetic retinopathy is ... among working-age adults while diabetic macular edema (DME) is the leading cause of decreased vision in ...

FDA Approves New SPRYCEL(R) (Dasatinib) Product Labeling for Patients with Chronic-Phase CML

... 16%), pleural effusion (10%, 18%), generalized edema (2%, 1%), congestive heart failure/cardiac ... 4%), pericardial effusion (1%, 2%), pulmonary edema (0%, 2%), pulmonary hypertension (0%, 1%), ... 0%), superficial edema (17%, 41%), generalized edema (2%, 4%), congestive heart failure/cardiac ...

ThromboGenics - Business Update and Interim Results for the Seven Month Period Ending 30 June 2007

... for Vitreomacular traction and diabetic macular edema (MIVI IIT and MIVI II, respectively). - ... the non-surgical treatment of diabetic macular edema (DME). DME is a complication of diabetic ... blinding eye diseases, such as diabetic macular edema (DME) and diabetic retinopathy (DR). It is ...

Cardiovascular Side Effects of Pioglitazone and Rosiglitazone Linked to Vascular and Energy Pathways by Genomas Clinical Study

... certain genes in vascular and energy pathways to body mass index (BMI) and edema (fluid retention) in patients taking the thiazolidinedione (TZD) drugs ... obesity, which exacerbate the diabetic condition itself, and to cause edema and exacerbate congestive heart failure in certain patients. Individuals ...

Video: Higher Initial Dose of Gleevec Achieved Better Early Responses than Standard Dose for Patients with Chronic Myeloid Leukemia

... (eg, pleural effusion, pulmonary edema, and ascites) and superficial edema (1.3%-11%), hemorrhage (1.8%-19%), and musculoskeletal pain (2%-9%) were ... most frequently reported adverse reactions (all Grades) were superficial edema (60%-74%), nausea (50%-73%), muscle cramps (28%-62%), vomiting (23%-58%), ...
Edema in Biological Definition

Brain

... caused by automobile accidents or other blows to the skull, is a leading cause of death. Often in these cases, more damage is caused by swelling, or edema , than by the impact itself. Stroke , caused by blockage of blood vessels in the brain, is another major cause of death and brain damage. Other ...
Edema in Biological Dictionary

Loop of Henle

... Loop diuretics are diuretics that act on the ascending loop of Henle in the kidney. They are primarily used in medicine to treat hypertension and edema often due to congestive heart failure or renal insufficiency. long, U-shaped portion of the tubule that conducts urine within each ...

Kwashiorkor

... malnutrition characterized by edema, irritability, anorexia, ulcerating dermatoses, and an enlarged liver with fatty infiltrates. The presence of edema caused by poor ... kwashiorkor ( ) n. Severe protein malnutrition, especially in children after weaning, marked by lethargy, growth ...

Hereditary

... hereditary kidney cancer tend to be diagnosed at a younger than ... This disease is also known as hereditary ... Hereditary angioneurotic edema (HANE) is a nonsex-linked (autosomal) dominant ... most hereditary . which is passed on as inheritance, by last ... Duke is a hereditary ...

Albumin

... in ... Albumin is a protein manufactured by the liver ... Low levels of albumin in the blood or its presence in urine may signal edema ... A total serum protein test measures the total amount of protein in the blood. Two major groups of proteins in the blood are albumin ...
Other Contentsmicrocephalymidwifemidwifeheadachesheadachesheadachesheadachesheadachesmigrainesmigrainesmigrainesmiliamiliaria
(Date:12/4/2009)... The renowned Center for mind-body medi...g the only natural immuno-boosting herbal suppleme...rveda. , San Diego, Calif...nprecedented illness due to factors such as stress... millions of people around the world are looking f...
(Date:12/3/2009)... With a membership increase of more tha...ement not only as a milestone in its history, but ...ce. Most associations are experiencing a decline i...o;At a time when trade organizations across the na...experiencing unprecedented growth, signaling that ...
(Date:12/3/2009)...INNEAPOLIS, Dec. 3 Children,s Hosp...cipient of the 2009 Leapfrog Top Hospitals Award. ...ering care that is among the best in the nation wh...y. ,, The Leapfrog survey is the only national,...uding mortality rates for common procedures, infec...
(Date:12/3/2009)...EVERLY HILLS, Calif., Dec. 3 Chris...ivine Design Gala and Premier Shopping Event for P...at 50-70% off regular prices. The event kicks off...December 7, 2009, located at 9900 Wilshire Bouleva...rnia. Please visit www.divinedesign.org for mor...
(Date:12/3/2009)...erforms widely used sulfonylureas, but each patien...RSDAY, Dec. 3 (HealthDay News) -- A class of drug...abetes is associated with a higher risk of dying a...n, researchers say. , , Sulfonylureas, long a m... than metformin in a study of oral anti-diabetes d...
Breaking Medicine News(10 mins):Health News:The Chopra Center for Wellbeing Launches Vedamune: An Ayurvedic Supplement to Support The Immune System 2Health News:Florida Medical Association Marks Record Membership Growth 2Health News:Children's Hospitals and Clinics of Minnesota Receives National Recognition for Quality and Efficiency 2Health News:Christian Audigier Represented at Divine Design for Project Angel Food 2Health News:Diabetes Drugs Go Head-to-Head in Study 2Health News:Diabetes Drugs Go Head-to-Head in Study 3
(Date:12/3/2009)...reef fish can undergo a personality change in warm...gesting that climate change may make some species ...of young damselfish on Australia,s Great Barrier R...ish are either consistently timid, or consistently...ven more marked as water temperatures rise. , A ...
(Date:12/3/2009)... dwellers must be included in the design of the up... a humanitarian crisis, according to a scientist a...Nature , Dr Simon Lewis argues that at least 50% o...hagen, known as REDD (Reducing Emissions from Defo...st dwellers directly, and their property rights as...
(Date:12/3/2009)... leads the world when it comes to investment in en...ing and Physical Sciences Research Council (EPSRC)...needed: "Scientific and engineering research has a...ar power solutions, but more investment is needed ... if we are to meet our carbon emission targets by ...
Breaking Biology News(10 mins):Fish with attitude: Some like it hot 2Forest deal at Copenhagen must avoid creating 'carbon refugees' 2Research is vital to a cleaner, greener, low carbon future 2Small optical force can budge nanoscale objects 14883 1Small optical force can budge nanoscale objects 14883 2MSC Appoints Linda Lane Senior VP Sales and Marketing 61578 1IEHP Ranks 232 in California Among Medicaid Health Plans 61573 1IEHP Ranks 232 in California Among Medicaid Health Plans 61573 2
Other TagstransferasetransferaseCaymanCorporationCorporationInstrumentsInstrumentsAbcamHYBHYBHYBHYBHYBAntibodyShopCorpCorpCorpCorpUSBUSBOther Tagsattached 2attached 3attached 4attached 5attached 6attached 7attached 8attached 9attached 10faces 2faces 3brought 2brought 3brought 4brought 5brought 6brought 7brought 8glial 2abnormal 2abnormal 3abnormal 4abnormal 5abnormal 6abnormal 7abnormal 8abnormal 9abnormal 10