Navigation Links


Mothers in Medical Technology

Children's Hospital Receives $6.7 Million Grant From Gates Foundation to Study Influenza Vaccine in Pregnant Women in Asia

... in infants, could also offer us a tool to help mothers protect their infants against influenza in this ... setting, that the influenza vaccine protects both mothers and their children," says Mark Steinhoff, M.D., ... understand the effect that vaccinating mothers has on unvaccinated family members. Studies ...

Video: New Survey Finds Mothers See Influenza as a Serious Health Threat, but Often Don't Get Their Families Vaccinated

... 2008 Faces of Influenza survey underscores that mothers need to get families immunized against influenza; ... Nov. 18 /PRNewswire/ -- While 78 percent of mothers in the United States consider influenza a severe ... and Prevention (CDC). Virtually all mothers (95 percent) in the survey say they have the ...

Women Who Gain Excessive Weight During Pregnancy More Likely to Have Overweight Children

... June 9 /PRNewswire-USNewswire/ -- Children of mothers who gain more than the recommended amount of ... Journal of Clinical Nutrition. Children of mothers who are obese prior to pregnancy and ... Using the IOM guidelines, children whose mothers exceeded the recommended weight gain were 48 ...

Nationwide Survey Reports that Mothers View Cleaning Homes and Toys as Essential to Preventing Colds & Flu

... ACE 2007 Germs survey clearly illustrates that mothers understand the threat of exposure to those germs ... teaching germ control. At the same time, 42% of mothers believe that their children will get sick no ... in 2005. When their children do get sick, 62% of mothers gave their kids some type of home remedy, such as ...

Influenza is Leading Cause of Vaccine-Preventable Deaths for Kids; Despite CDC Recommendations, Moms Still Don't Vaccinate

... About the Survey Survey results are based on 1,080 online interviews with mothers of children under 10 years of age from across the United States. ... points of what they would have been had the entire population of mothers with children under 10 years of age in the United States had been ....

European Experts Recommend Pregnant and Nursing Women Take More DHA - Every Day

... nutritional deficiencies. "In addition to DHA, it is well known that mothers need folic acid for a healthy pregnancy." Doctors are now using PBM's ... and vitamins B6 and B12 to expectant and nursing mothers, as well as new mothers with postpartum depression. Each capsule of Animi-3 contains 500 mg of ...

Sosei and Vectura Announce Start of Phase III Clinical Study With NVA237

... England and TOKYO, June 29 /PRNewswire/ -- - Study Triggers $7.5m Milestones for Both Companies Sosei Group Corporation ("Sosei"; TSE mothers Index: 4565) and Vectura Group plc ("Vectura"; LSE: VEC) announce the commencement of a Phase III clinical study by Novartis, with NVA237, a ...

Continued Overall Survival Advantage Reported From Pivotal Trial of VELCADE(R) (Bortezomib) for Injection Based Therapy in Patients With Previously Untreated Multiple Myeloma

... tumor lysis syndrome and hepatic events. Women of childbearing potential should avoid becoming pregnant while being treated with VELCADE. Nursing mothers are advised not to breastfeed while receiving VELCADE. Cases of severe sensory and motor peripheral neuropathy have been reported. The long-term ...

Prolonged Progression-Free Survival Demonstrated by VELCADE(R) (Bortezomib) for Injection Based Induction Regimens in Transplant-Eligible Previously Untreated Multiple Myeloma Patients

... tumor lysis syndrome and hepatic events. Women of childbearing potential should avoid becoming pregnant while being treated with VELCADE. Nursing mothers are advised not to breastfeed while receiving VELCADE. Cases of severe sensory and motor peripheral neuropathy have been reported. The long-term ...

Sosei Confirms the Safety of SD118 in Two Phase I Trials

... TOKYO, December 8 /PRNewswire-FirstCall/ -- Sosei Group Corporation ("Sosei"; TSE mothers Index: 4565), a biopharmaceutical company, today announces the successful results of two Phase I trials for its collaborative project on SD118, a ...

Novel VELCADE(R) (Bortezomib) for Injection Based Four-Drug Combination Was Well Tolerated In Previously Untreated Multiple Myeloma Patients

... tumor lysis syndrome and hepatic events. Women of childbearing potential should avoid becoming pregnant while being treated with VELCADE. Nursing mothers are advised not to breastfeed while receiving VELCADE. Cases of severe sensory and motor peripheral neuropathy have been reported. The long-term ...

Sosei and NeuroSolutions Present Further Data on NSL-043/SD118 at the Society for Neuroscience 38th Annual Meeting

... -- NeuroDiscovery Ltd (ASX: NDL), a specialty neuroscience service provider and drug development Company, and Sosei Group Corporation ("Sosei"; TSE mothers Index: 4565), a leading international biopharmaceutical company, today announce that NeuroSolutions is presenting further pivotal pre-clinical ...

Vical Completes Enrollment and Reports Positive Interim Data in CMV Vaccine Phase 2 Trial

... potentially leading to severe illness or death. These include transplant patients who take immunosuppressive drugs, and fetuses and newborns of mothers who first become infected during pregnancy. CMV infection affects 30 to 60 percent of the patients undergoing various transplant procedures, ...

NVA237 Phase II Results Presented at the European Respiratory Society Annual Meeting Show Promising Efficacy and Tolerability With Potentially Faster Onset Than Tiotropium

... TOKYO and CHIPPENHAM, England, October 7 /PRNewswire-FirstCall/ -- Sosei Group Corporation ("Sosei"; TSE mothers Index: 4565) and Vectura Group plc ("Vectura"; LSE: VEC), announce results of two Phase II studies evaluating the efficacy, safety and tolerability ...

New England Journal of Medicine Publishes Phase III Results of VELCADE(R) (Bortezomib) for Injection in Previously Untreated Multiple Myeloma Patients

... tumor lysis syndrome and hepatic events. Women of childbearing potential should avoid becoming pregnant while being treated with VELCADE. Nursing mothers are advised not to breastfeed while receiving VELCADE. Cases of severe sensory and motor peripheral neuropathy have been reported. The long-term ...

Abbott's Kaletra(R) Tablet Dosed Once-Daily or Twice-Daily Demonstrated Similar Clinical Results Across Race and Gender Lines

... with hemophilia have increased bleeding with protease inhibitors. The effects of KALETRA on pregnant women or their unborn babies are not known. mothers taking KALETRA should not breast-feed. All strengths of KALETRA tablets should be swallowed whole and not chewed, broken, or crushed. KALETRA ...

Sosei Announces Completion of Phase III Trial for NorLevo(R)

... TOKYO, July 10 /PRNewswire-FirstCall/ -- Sosei Group Corporation ("Sosei"; TSE mothers Index: 4565), the biopharmaceutical company, today announced the completion of a Japanese Phase III clinical trial for the emergency contraceptive ...

Pressure Cycling Technology (PCT) Results in a Higher Yield of Proteins and in the Extraction of Proteins Not Previously Identified in Cancer, Stroke, and IVF Studies

... combat these diseases." Dr. Pevsner continued: "Many IVF live births result in twins, triplets, and higher order births. Unfortunately, fetuses and mothers of multiple and high-order multiple pregnancies have increased morbidity and mortality. To combat this, more single embryo transfers are needed. To ...

Promise of Vical's CMV Vaccine Noted by Independent Experts

... potentially leading to severe illness or death. These include transplant patients who take immunosuppressive drugs, and fetuses and newborns of mothers who first become infected during pregnancy. CMV infection affects 30 to 60 percent of the patients undergoing various transplant procedures, ...

Pregnant Women Need Omega-3 to Boost Infant Development

... and B vitamins. "Physicians are using Animi-3 to deliver DHA, folic acid, and other vital nutrients to pregnant and nursing women, as well as new mothers with postpartum depression," said PBM Pharmaceuticals President Jack Schramm. "The DHA in Animi-3 is all natural and purified to eliminate ...

Clinically Proven Treatment Offers Help to Rosacea Sufferers

... According to Lepage, that's just not true. "People usually get (rosacea) through close contact with others when they are babies, such as mothers breastfeeding their children," he said. "The parasite can live under the skin and not appear for years." The National Rosacea Society has found ...

Leukemia Therapy With Imatinib During Pregnancy May Cause Infant Abnormalities

... a dose-related relationship. There were no reports of maternal exposure to alcohol, drugs, or tobacco addiction during pregnancy, and none of the mothers had received other high-dose chemotherapy prior to their pregnancies. "The risks and benefits to an expectant woman fighting cancer and her fetus ...

Infant Formula Manufacturers Again under Ethical Cloud: 'Marketing Gimmick' Linked to Serious Illnesses

... red flags during preapproval testing while aggressive marketing campaigns by some infant formula manufacturers appear to have encouraged new mothers to give up nursing for the questionable products. "When I worked in the hospital's neonatal ward, the nurses all called it 'the diarrhea ...

Simple Test Accurately Predicts Risk of Serious Jaundice in Newborns

... of colored light used to break down the bilirubin, before meeting the criteria. Finally, about half of the study participants were born to black mothers and the researchers' data indicates black infants are less prone to develop significant hyperbilirubinemia. "More research on risk-assessment ...

Olympic Gold Medalist Kristi Yamaguchi Joins American Lung Association of Michigan to Address Seriously Low Vaccination Rates; Urge Metro-Detroiters to Get Immunized This Season

... Pop Star Challenge, are also partnering on the campaign to encourage increased immunization in Michigan. Karen and LaShell, both mothers of children with asthma, know firsthand the importance of vaccination against this dangerous illness, which causes between ...

Measles Deaths in Africa Plunge by 91%

... Crescent family, as well as our dedicated partners, such as the Latter-day Saints, we literally go door-to-door informing, educating and motivating mothers and caregivers about the critical need to vaccinate their children," said Bonnie McElveen-Hunter, Chairman of the Board of the American Red Cross. ...

Childhood Influenza Immunization Coalition Encourages Vaccination Throughout the Influenza Season

... an influenza risk calculator and frequently asked questions about influenza vaccines. Coalition members include Allergy & Asthma Network mothers of Asthmatics, American Academy of Pediatrics, American College of Cardiology, American College of Obstetricians and Gynecologists, American ...

38.7 Million People Break Guinness World Record for Stand Up Speak Out on International Day for the Eradication of Poverty

... together to eradicate extreme poverty and hunger, ensure all boys and girls complete primary school, promote gender equality, improve the health of mothers and children, reverse the spread of HIV/AIDS, protect the environment, and create a global partnership for development by ensuring rich countries ...

Interim Safety Data Favorable for Vical's Phase 2 Trial of DNA Vaccine Against CMV

... potentially leading to severe illness or death. These include transplant patients who take immunosuppressive drugs, and fetuses and newborns of mothers who first become infected during pregnancy. CMV infection affects 30 to 60 percent of the patients undergoing various transplant procedures, causing ...

US FDA Grants Orphan Drug Status to Immtech's Pafuramidine for Treatment of African Sleeping Sickness

... been positive to date, and the FDA and Ethics Committees responsible for the study oversight currently allow adolescents, pregnant women and nursing mothers to participate in these clinical trials. These groups are particularly vulnerable to the disease. "The FDA's decision reflects the significant need ...

New England Journal of Medicine Publishes New Data on Gardasil, Merck's Cervical Cancer Vaccine

... to a nursing woman. A total of 995 nursing mothers (vaccine = 500, placebo = 495) were given ... trials. GMTs in nursing and non-nursing mothers were as follows: The GMTs in nursing mothers were 595.9 (95% CI: 522.5, 679.5) for anti-HPV ...

Data Published in The Lancet Show Gardasil was 100 Percent Effective in Preventing High-Grade Vulvar and Vaginal Lesions Caused by HPV Types 16 and 18

... to a nursing woman. A total of 995 nursing mothers (vaccine = 500, placebo = 495) were given ... trials. GMTs in nursing and non-nursing mothers were as follows: The GMTs in nursing mothers were 595.9 (95% CI: 522.5, 679.5) for anti-HPV ...

Waismann Method Survey Reveals 65 Percent of Women Seeking Opiate Dependency Treatment Are Mothers

... Fentanyl were among the drugs cited. In addition, 35 percent of the mothers who reported a dependency said they suffered from depression, according to ... it incredibly dangerous." Additional survey results include: -- Of mothers who reported suffering a dependency to opiates, more than 76 percent were ...

Common Preterm Labor Drug Has More Side Effects Than Alternative, Finds Study from Packard Children's Hospital and Stanford

... more strongly when choosing which drug to prescribe. Newborns whose mothers had received magnesium sulfate were also more likely to be admitted to the neonatal intensive care unit than those whose mothers had received the alternative treatment, although the data do not offer an ...

Sciele Pharma Announces Successful Completion of New Sular Formulation Clinical Trial Program

... triglycerides, unstable angina and Type 2 diabetes, and its Women's Health products are designed to improve the health and well-being of women and mothers and their babies. Founded in 1992 and headquartered in Atlanta, Georgia, Sciele Pharma employs more than 800 people. The Company's success is based ...

SkyePharma and Sciele Pharma Announce Successful Completion of New Sular Formulation Clinical Trial Programme

... triglycerides, unstable angina and Type 2 diabetes, and its Women's Health products are designed to improve the health and well-being of women and mothers and their babies. Founded in 1992 and headquartered in Atlanta, Georgia, Sciele Pharma employs more than 800 people. The Company's success is based ...

Five Days of LEVAQUIN(R) as Effective as 10 Days of Ciprofloxacin in Complicated Urinary Tract Infections and Acute Pyelonephritis

... nausea (1.5%) and diarrhea (1.2%). The safety and efficacy of LEVAQUIN in pediatric patients, adolescents (under 18), pregnant women, and nursing mothers have not been established. LEVAQUIN is contraindicated in persons with a history of hypersensitivity to LEVAQUIN, quinolone antimicrobial agents, ...
Other Contentsmicrocephalymidwifemidwifeheadachesheadachesheadachesheadachesheadachesmigrainesmigrainesmigrainesmilia
(Date:11/24/2009)...el action of a remarkable class of ring-shaped pro... the Lawrence Berkeley National Laboratory (Berkel...graphy beamline at the Advanced Light Source (ALS)...expression and replication, and are vital to the s...ious agents, such as the human papillomavirus, whi...
(Date:11/24/2009)... (November 24, 2009) New research on bacterial co...tems reveals predictable temporal patterns, sugges...s markers for monitoring climate change in the pol... Proceedings of the National Academy of Sciences ... the six rivers shifted synchronously over time, c...
(Date:11/23/2009)...ember 23, 2009 - The time of day matters to forest...per produced by a research team led by Professor M...,s vice-principal for research and colleagues in t...t. George campus. , Capitalizing on their prev... the research team examined how poplar trees use t...
Breaking Biology News(10 mins):Atomic-level snapshot catches protein motor in action 2Atomic-level snapshot catches protein motor in action 3Atomic-level snapshot catches protein motor in action 4Researchers establish common seasonal pattern among bacterial communities in Arctic rivers 2Time of day matters to thirsty trees, U of T researcher discovers 2Combo Treatment May Ease Depression After Stroke 53891 1Combo Treatment May Ease Depression After Stroke 53891 2Stroke Doubles Risk of Hip Thigh Fractures 53889 1Stroke Doubles Risk of Hip Thigh Fractures 53889 2Stroke Doubles Risk of Hip Thigh Fractures 53889 3Carnegie donates landmark clones to biology 9509 1Carnegie donates landmark clones to biology 9509 2
(Date:11/25/2009)....25/PRNewswire/-SentinelleMedicalInc.,aleadingmanu...ftwarelaunchesasuiteofnewleadingedgeclinicalapplic...atthisyear,sRadiologicalSocietyofNorthAmerica(RSNA...0,HallA).Theapplicationsleveragetheuniquehighquali...ngcoilsandsupportmultipleimagingmodalitiesformulti...
(Date:11/25/2009)...icalEndorsements,Business,andPressJoinEfforttoEduc...ire/--Onceagain,theNationalBipolarFoundationandthe...heir"Safe,tilStable"program,whichisnowbeingwidelya...order.Today,theNationalBipolarFoundationreceivedap...ailfromtheLt.GovernorofLouisianaMitchLandrieu.TheN...
(Date:11/25/2009)... period was too short to draw definite conclusions...HealthDay News) -- In diabetic patients with block...rence in outcomes at one year whether patients und...British researchers report. , Bypass surgery ha...s with coronary artery disease. However, less inva...
(Date:11/25/2009)...te, CDC sees few signs of trouble with the H1N1 va...y News) -- The ongoing H1N1 swine flu pandemic may... among younger patients, a U.S. health official sa...erious pneumococcal infections around the country,...er for Immunization and Respiratory Diseases at th...
(Date:11/25/2009)...eat colorectal cancer also can reverse a rare stom...herapy for the disease, researchers at Vanderbilt ...rier,s disease causes thickening of the stomach li...as well as anemia and swelling in the feet and ank... risk for gastric cancer. Previously, the only eff...
Breaking Medicine News(10 mins):Health News:Sentinelle Medical Launches Aegis Suite of Oncology 4D Visualization Software with PureWeb(TM) Technology 2Health News:Sentinelle Medical Launches Aegis Suite of Oncology 4D Visualization Software with PureWeb(TM) Technology 3Health News:First Time-Door is Open for Family Discussion of Bipolar Disorder 2Health News:First Time-Door is Open for Family Discussion of Bipolar Disorder 3Health News:Stenting May Equal Bypass for Diabetic Heart Patients 2Health News:Stenting May Equal Bypass for Diabetic Heart Patients 3Health News:Swine Flu Tied to Rise in Pneumonias Among Young 2Health News:Swine Flu Tied to Rise in Pneumonias Among Young 3Health News:Swine Flu Tied to Rise in Pneumonias Among Young 4Health News:Vanderbilt scientists report first effective medical therapy for rare stomach disorder 2
Other TagsplayersSolomonfilmfilmfilmfilmhonorhonorassistsforecastOther Tagsrhesus 2nature 2nature 3nature 4nature 5nature 6nature 7nature 8nature 9nature 10