Navigation Links


Energy in Medical Technology

July 2009 Mayo Clinic Women's HealthSource Highlights Food Storage Safety, Energy Therapies and Vitamins and Minerals

... suspicious should be tossed. energy Therapies -- A Complementary Approach to Promote Well-Being ROCHESTER, Minn. -- energy therapies such as healing touch, qi gong and ... of Mayo Clinic Women's HealthSource . energy therapies are considered complementary and ...

SUNY Youth Sports Institute Convenes Top Experts in NYC Next Week to Present Research & Analysis on Energy Drink Health Impacts

... designed to explore the health impacts of energy drinks will be held next week in New York City ... on the health impacts that the $5 billion-a-year energy drink industry has on today's youth and ... "At a recent count there were nearly 500 energy drink brands. Classified as supplements and ...

Pivotal Clinical Data Published for the Only Laser Phototherapy Device Cleared by the FDA for Hair Growth

... About the HairMax LaserComb The laser energy emitted by the HairMax LaserComb is hypothesized ... hair follicle then has the building blocks and energy to transform from a weakened follicle to one that ... mechanism to part the hair to allow the laser energy to penetrate the scalp into the hair follicles. ...

PEAK Surgical Announces Completion of First PRECISE Clinical Study, Receipt of Medical Design Excellence Award for PEAK(R) Surgery System and Achievement of Over 1,000 Surgeries Using PEAK PlasmaBlade(TM)

... as the PRECISE (Pulsed Plasma Radiofrequency energy to ReduCe Thermal Injury and Improve Surgical ... Generator supplies pulsed plasma radiofrequency energy to the PlasmaBlade to incise tissue and control bleeding. Because the radiofrequency energy is provided through short on-and-off pulses via a ...

Research Shows VASER(R) Lipo Results in Excellent Skin Tightening

... of the clear advantage of using VASER ultrasonic energy in all body contouring procedures." Most ... tightening. The precision of the VASER ultrasonic energy allows a physician to safely treat this area to ... in the abdomen and back. VASER ultrasonic energy is able to selectively liquefy fat while ...

Studies Show Combination Laser Therapy Effective At Clearing Acne, Reducing Oil Production

... cases of acne. PDT works by using laser or light energy - in this case a pulsed dye laser was used - to ... as systemic or topical medications) or with laser energy but without ALA PDT. Upon analyzing the ... control group who were treated with either laser energy alone or conventional therapy achieved complete ...

US Testing Proves Glyc'n Go(TM) Increases NO in the Blood Stream

... oxygen and nutrient delivery for cellular energy production and 2.) removing metabolic wastes such ... acids into the cell's mitochondria, enhancing ATP energy production. In addition to the NO and energy benefits; Glyc'n Go(TM) provides antioxidant ...

PEAK Surgical Receives 510(k) Clearance to Market PEAK(R) Surgery System for Use in Expanded Indications

... the PRECISE Studies (Pulsed Plasma Radiofrequency energy to ReduCe Thermal Injury and Improve Surgical ... which provides pulsed plasma radiofrequency energy to the PlasmaBlade to incise tissue and control ... the PlasmaBlade. Because the radiofrequency energy is provided through short on-and-off pulses via a ...

Concord Grape Juice Has No Significant Impact on Body Weight

... was not associated with changes in appetite, energy intake or body weight CONCORD, Mass., Oct. 6 ... people generally do not eat less after consuming energy from beverages to the same extent as they reduce dietary energy intake after eating," said Dr. Richard ...

Battelle Scientists Named on Patent for Making Oxygen From Light and Water

... what plants do when they absorb sunlight energy and convert it into useful chemicals. Known by ... Laboratory Management, National Security, energy Technology, and Health and Life Sciences. It ... manages or co-manages for the U.S. Department of energy and the U.S. Department of Homeland Security. ...

September 2008 Mayo Clinic Health Letter Highlights Cataract Removal, Severe Headache and Dual Energy X-Ray Imaging

... side effects to best manage the illness. Dual energy X-Ray Imaging -- A Better View ROCHESTER, Minn. ... shows that using two different levels of X-ray energy is better than one, according to the September ... Health Letter. The new technology, called dual energy X-ray imaging, goes beyond the single perspective ...

Kingfisher Announces FDA 510(k) Clearance of Breakthrough KFH Energy for Chronic Pain Sufferers

... the company 510(k) clearance to market KFH energy in the United States. The patented, high-tech ... syndrome. "We are thrilled to introduce KFH energy to physicians, specialists, and patients ... devices for a variety of treatments." KFH energy utilizes a unique form of micro current ...

Popular Energy Drinks Cause Tooth Erosion

... The price paid for higher energy is highly dangerous to teeth CHICAGO, March ... billion by 2010. While that may be great news for energy drink companies, it could mean a different story ... According to the study, the popularity of energy drinks is on the rise, especially among ...

Boston University Biomedical Engineers Find Chink in Bacteria's Armor

... that says, 'There's something wrong with our energy production system and we need to make more ... a surprising change in genes responsible for energy production and iron uptake. In the current ... along the intracellular assembly lines that make energy for the bacterial cell, just as in the earlier ...

Experimental Drug Ketasyn(TM) Improves Memory in Age-Associated Memory Impairment Study

... into ketone bodies, which the brain can use for energy even when its ability to process glucose is ... support the hypothesis that providing additional energy reserves to the elderly brain improves a variety ... by the liver into ketone bodies, an alternative energy source that the brain can utilize when ...

The Heart, Diabetes, And Weight Loss Centers of New York Introduce the New Science of Metabolic Diagnosis and Weight Management

... the body's basal metabolic rate or resting energy expenditure and locates a weight management zone. ... band 5-10 days at home to measure four key energy parameters: skin temperature, galvanic skin ... result of this 3-step test is a reading of total energy expenditure per day/per week, of calories burnt, ...

Debiopharm Group and Mercury Therapeutics, Inc. Sign an Exclusive License Agreement for the Development and Commercialisation of Debio 0930

... is a hormone that is needed to convert sugar, starches and other food into energy needed for daily life. The cause of diabetes continues to be a mystery, ... novel compounds that directly activate AMPK, a key regulator of whole body energy metabolism, cholesterol and fatty acid production, and cell division. ...

New AHRQ Study Finds Mixed Evidence on Use of Radiofrequency Catheter Ablation for Treating Atrial Fibrillation

... Md., July 6 /PRNewswire-USNewswire/ -- A procedure that sends targeted energy into the heart through a catheter can be used to treat a common type of ... the heart - often is used when medications do not work. In this procedure, energy pulses are delivered through the catheter to the heart, destroying small ...

First Jatropha Genome Completed by Synthetic Genomics Inc. and Asiatic Centre for Genome Technology

... sequenced genome of jatropha will enable us to develop new, sustainable energy feedstocks that grow on marginal land or in more arid climates and that do ... developing and commercializing genomic-driven solutions to address global energy and environment challenges. Advances in synthetic genomics present ...

Pelleve Receives FDA Clearance for the Treatment of Mild to Moderate Facial Wrinkles

... Dual RF(TM) S5 and a proprietary Pelleve handpiece to precisely deliver energy through the skin to the dermal tissue beneath without damaging the ... The Surgitron Dual RF S5 provides maximum control in precision cutting and energy delivery, with more versatility than other energy-based technologies. ...

Midwest Research Institute Launches Clinical Molecular Diagnostics Laboratory

... conducting research in the areas of national security and defense, energy and environment, life sciences, food and agriculture, and transportation ... Energy, LLC, that manages and operates the National Renewable energy Laboratory (NREL) in Golden, Colo., for the U.S. Department of Energy. ...

Cynosure Announces Presentation of Favorable Results from Post-Marketing Studies of Smartlipo MPX

... first study to illustrate the effects of subdermal applications of laser energy on skin laxity and tissue tightening," Dr. DiBernardo said. "The ability ... products include a broad range of laser and other light-based energy sources, including Alexandrite, pulsed dye, Nd:YAG and diode lasers, as ...

Walter Reed Army Medical Center offers HIFU for Qualifying Men with Locally Recurrent Prostate Cancer in a Phase III Clinical Trial

... outpatient procedure that uses a transrectal probe to focus ultrasound energy resulting in a therapeutic rise in heat within the prostate. This results ... 500 is a minimally invasive medical device that utilizes ultrasound energy to destroy tissue within the body. It was developed by FSI and is ...

New Study Published in the Journal of Drugs in Dermatology Finds DOT Microablative CO2 Laser Optimum for Skin Rejuvenation

... The DOT procedure ( www.dottherapy.com ) precisely delivers CO2 laser energy to targeted areas on the face or non-facial areas like the neck and ... deep into the dermis and stimulate the growth of new collagen. The energy is applied in a "fractional" way in which tiny columns of thermal damage ...

Experience Not Always the Best Prescription for Snowblowers

... the machine is not running because clogged impeller blades retain stored energy in the elastic drive belts of the machine. As such, once a clog has been removed from the blades, the drive belts are free to release that stored energy causing the blades to spin again, potentially leading to significant ...

Next Generation Proton Therapy System for Cancer Treatment Set for Release This Year

... today the successful operation of the world's highest field, high energy cyclotron magnet. Still River's magnet is the key technical element for ... "This magnet sets a record for magnetic field strength used in a high energy cyclotron. The cyclotron built around this magnet will be the most compact ...

Plastic Surgeons Warn of Malnutrition in Body Contouring Patients

... accelerate wound healing, improve scar quality and boost patient energy levels, according to a study in the December issue of Plastic and ... wound tension, and scar quality, in addition to increasing patients' energy levels. Because of reduced calorie intake for massive weight loss ...

Bionovo Advances BZL101 to Phase 2 Clinical Trials After Positive Phase 1 Results for Metastatic Breast Cancer

... on the citric acid cycle (>85%) and very little on glycolysis (<7%) for energy production. Cancer cells depend largely on glycolysis (>85%) for energy production. BZL101 stops the production cycle of energy in cancer cells by ...

Texas Cardiac Arrhythmia Institute at St. David's Medical Center Selected to Conduct Clinical Trial for Device to Treat Atrial Fibrillation

... with cardiac ablation -- a procedure that allows physicians to deliver energy directly to the heart muscle at precise points that trigger the ... giving electrophysiologists the ability to better control the delivery of energy through the catheter and generate a more effective lesion." In traditional ...

NeoVista Unveils 18-month Data on Novel Wet AMD Therapy at Retina Society Meeting

... therapy for wet AMD, NeoVista's approach delivers the peak dose of energy directly to the lesion without damaging the normal retinal vasculature. Utilizing strontium 90, the focused energy is delivered to a target area up to 3 mm in depth and up to 5.4 mm in ...

New Research Shows One in 200 People Born with DNA Mutation That Can Lead to Devastating, Often Fatal Disease

... for years. They develop when the mitochondria - the body's main energy source - do not function properly. Mitochondria are responsible for creating more than 90 percent of the energy needed by the body to sustain life and support growth. Because they are in ...

Nature Publication Reports on Key Role of Bile Acids in Glucose Metabolism and Insulin Signaling

... levels. -- The activation of TGR5 by bile acids increases energy expenditure and reduces diet-induced obesity. Conversely, "knockout" ... the G protein-coupled receptor TGR5. These receptors are key mediators of energy homeostasis and are involved in maintaining integral functions of the ...

Discovering How Video Games Can Motivate Healthy Behaviors: More than $2 Million Awarded to 12 Research Teams Across U.S.

... for people aged 18 to 35. The study will compare physiological measures of energy expenditure while people play traditional video games (those that involve ... time that research will identify impacts of these factors on players' energy expenditure; study results may lead to recommendations for making ...

Amylin Pharmaceuticals Initiates Phase 2B Dose-Ranging Clinical Study of Pramlintide/Metreleptin Combination Treatment in Obesity

... and Clinical Studies." "Leptin is a fundamentally important hormone in energy metabolism with a unique role in inducing fat-specific weight loss and in ... secreted by fat cells that plays a fundamental role in the regulation of energy metabolism and body weight. Amylin acquired exclusive rights to the leptin ...

Bionovo Announces Publication of the Paper Detailing the Mechanism of Action of Its Cancer Drug BZL101

... on the citric acid cycle (>85%) and very little on glycolysis (<7%) for energy production. In contrast, cancer cells depend largely on glycolysis (>85%) for energy production. BZL101 leads to energy collapse in cancer cells by inhibiting ...

NeoVista Presents One Year Data on Novel Wet AMD Therapy at Macula Society

... therapy for wet AMD, NeoVista's approach delivers the peak dose of energy directly to the lesion without irreparably damaging the normal retinal vasculature. Utilizing strontium 90, the focused energy is delivered to a target area up to 3 mm in depth and up to 5.4 mm in ...

Treatment Gives Lung Cancer Patients With Inoperable Tumors Two Years or More

... deliver targeted cancer treatments throughout the body. Radiofrequency energy can be given without affecting a patient's overall health, and most people ... tumor, generally by computed tomography (CT). Radiofrequency (electrical) energy is transmitted to the tip of the needle where it produces heat in the ...

Bionovo Announces Positive Developments in On-going Phase 1/2 Cancer Drug Trial

... on the citric acid cycle (>85%) and very little on glycolysis (<7%) for energy production. In contrast, cancer cells depend largely on glycolysis (>85%) for energy production. BZL101 leads to energy collapse in cancer cells by inhibiting ...

Portrait(R) Plasma - A New Non-Surgical Option for one of the Most Requested Aesthetic Treatment - Aging Eyes

... with outdated laser procedures. The hand-piece delivers nitrogen plasma energy that works both at and below the surface of the skin to modify its ... for the dermatological, plastic and cosmetic surgery markets. Plasma energy stimulates a true, natural skin regenerative process that is supported by ...

Avicena Scientific Collaborator Advances Program for Using Energy Enhancing Molecules to Treat Neuromuscular Diseases

... presented a summary of findings demonstrating the positive effect of energy enhancing compounds for the potential treatment of neuromuscular diseases. ... and is part of an ongoing collaborative program with Avicena to identify energy enhancing molecules as potential therapeutic agents for applications in ...
Other Contentsmicrocephalymidwifemidwifeheadachesheadachesheadachesheadachesheadachesmigrainesmigrainesmigrainesmilia
(Date:11/24/2009)...el action of a remarkable class of ring-shaped pro... the Lawrence Berkeley National Laboratory (Berkel...graphy beamline at the Advanced Light Source (ALS)...expression and replication, and are vital to the s...ious agents, such as the human papillomavirus, whi...
(Date:11/24/2009)... (November 24, 2009) New research on bacterial co...tems reveals predictable temporal patterns, sugges...s markers for monitoring climate change in the pol... Proceedings of the National Academy of Sciences ... the six rivers shifted synchronously over time, c...
(Date:11/23/2009)...ember 23, 2009 - The time of day matters to forest...per produced by a research team led by Professor M...,s vice-principal for research and colleagues in t...t. George campus. , Capitalizing on their prev... the research team examined how poplar trees use t...
Breaking Biology News(10 mins):Atomic-level snapshot catches protein motor in action 2Atomic-level snapshot catches protein motor in action 3Atomic-level snapshot catches protein motor in action 4Researchers establish common seasonal pattern among bacterial communities in Arctic rivers 2Time of day matters to thirsty trees, U of T researcher discovers 2Combo Treatment May Ease Depression After Stroke 53891 1Combo Treatment May Ease Depression After Stroke 53891 2Stroke Doubles Risk of Hip Thigh Fractures 53889 1Stroke Doubles Risk of Hip Thigh Fractures 53889 2Stroke Doubles Risk of Hip Thigh Fractures 53889 3Carnegie donates landmark clones to biology 9509 1Carnegie donates landmark clones to biology 9509 2
(Date:11/25/2009)....25/PRNewswire/-SentinelleMedicalInc.,aleadingmanu...ftwarelaunchesasuiteofnewleadingedgeclinicalapplic...atthisyear,sRadiologicalSocietyofNorthAmerica(RSNA...0,HallA).Theapplicationsleveragetheuniquehighquali...ngcoilsandsupportmultipleimagingmodalitiesformulti...
(Date:11/25/2009)...icalEndorsements,Business,andPressJoinEfforttoEduc...ire/--Onceagain,theNationalBipolarFoundationandthe...heir"Safe,tilStable"program,whichisnowbeingwidelya...order.Today,theNationalBipolarFoundationreceivedap...ailfromtheLt.GovernorofLouisianaMitchLandrieu.TheN...
(Date:11/25/2009)... period was too short to draw definite conclusions...HealthDay News) -- In diabetic patients with block...rence in outcomes at one year whether patients und...British researchers report. , Bypass surgery ha...s with coronary artery disease. However, less inva...
(Date:11/25/2009)...te, CDC sees few signs of trouble with the H1N1 va...y News) -- The ongoing H1N1 swine flu pandemic may... among younger patients, a U.S. health official sa...erious pneumococcal infections around the country,...er for Immunization and Respiratory Diseases at th...
(Date:11/25/2009)...eat colorectal cancer also can reverse a rare stom...herapy for the disease, researchers at Vanderbilt ...rier,s disease causes thickening of the stomach li...as well as anemia and swelling in the feet and ank... risk for gastric cancer. Previously, the only eff...
Breaking Medicine News(10 mins):Health News:Sentinelle Medical Launches Aegis Suite of Oncology 4D Visualization Software with PureWeb(TM) Technology 2Health News:Sentinelle Medical Launches Aegis Suite of Oncology 4D Visualization Software with PureWeb(TM) Technology 3Health News:First Time-Door is Open for Family Discussion of Bipolar Disorder 2Health News:First Time-Door is Open for Family Discussion of Bipolar Disorder 3Health News:Stenting May Equal Bypass for Diabetic Heart Patients 2Health News:Stenting May Equal Bypass for Diabetic Heart Patients 3Health News:Swine Flu Tied to Rise in Pneumonias Among Young 2Health News:Swine Flu Tied to Rise in Pneumonias Among Young 3Health News:Swine Flu Tied to Rise in Pneumonias Among Young 4Health News:Vanderbilt scientists report first effective medical therapy for rare stomach disorder 2
Other TagsplayersSolomonfilmfilmfilmfilmhonorhonorassistsforecastOther Tagsrhesus 2nature 2nature 3nature 4nature 5nature 6nature 7nature 8nature 9nature 10