Navigation Links


Channel in Medical Technology

Video: UCB Launches Vimpat(R) in the U.S. for Add-On Treatment of Epilepsy in Adults

... been shown to involve the modulation of sodium channel activity in the nervous system. Sodium channels ... for Vimpat(R) is thought to reduce this sodium channel over-activity by enhancing the longer lasting ... a different action compared with current sodium channel blocking drugs. This action then regulates the ...

New Data Shows AZOR(R) (amlodipine and olmesartan medoxomil) Significantly Improves 24-Hour Ambulatory Blood Pressure

... not adequately controlled with any calcium channel blocker or any angiotensin receptor blocker ... acute myocardial infarction on starting calcium channel blocker therapy or at the time of dosage ... Congestive Heart Failure In general, calcium channel blockers should be used with caution in patients ...

Dendreon Presents Preclinical Data Demonstrating Activity of TRPM8 Agonist, D-3263, in Benign Prostatic Hyperplasia

... which targets TRPM8 (a transmembrane cation channel protein), to treat benign prostatic hyperplasia ... (#1408), "Preclinical Evaluation of the TRPM8 Ion channel Agonist D-3263 for Benign Prostatic Hyperplasia" ... in-house discovery efforts. It is an ion channel that is triggered by cold temperatures and ...

Dendreon Initiates Phase 1 Clinical Trial of Small Molecule Targeting TRPM8 in Cancer

... designed to target TRPM8 (a transmembrane cation channel protein) in cancer cells and induce cell death. ... in-house discovery efforts. It is an ion channel that is triggered by cold temperatures and ... including D3263 that activate the TRPM8 ion channel and induce cell death. About Dendreon ...

Study Shows Leconotide, an Investigative Calcium Channel Blocker, Has Potential as a Selective, Efficacious, Non-Opioid Pain Treatment

... study of leconotide, an investigative calcium channel blocker, shows it has the potential to be safe, ... as has been seen in studies of other calcium channel blockers used for treating pain. It was ... the rodents were given injections of two calcium channel blockers (leconotide or ziconotide) alone and in ...

/C O R R E C T I O N -- Prof Terje Pedersen, SEAS Study Principal Investigator & Head of Steering Committee/

... Satellite: AB1 12.5 Deg West Txp: B6 Lower, channel 2 DL: 11152.700 V symbol rate 5.632 FEC 3/4 ... Galaxy 11 @ 91 degrees west KU Band: Txp 13, channel A DL: 11946.5 H SYMBOL RATE 5.632 FEC 3/4 ... Satellite: AB1 12.5 Deg West Txp: B6 Lower, channel 2 DL: 11152.700 V symbol rate 5.632 FEC 3/4 ...

Dendreon Presents Preclinical Data Demonstrating Activity of Trp-p8 agonist, D-3263, in Benign Prostatic Hyperplasia

... which targets Trp-p8 (a transmembrane cation channel protein also known as Trp-M8), to treat benign ... discovery efforts. It is an ion channel that is triggered by cold temperatures and ... molecule agonists that activate the Trp-p8 ion channel and induce cell death. The lead molecule, D-3263, ...

Parion Sciences Announces Phase I Clinical Results for Novel Dry Mouth Treatment

... a Phase I clinical safety study of a novel sodium channel blocker, P-552-02, as a topical therapy for dry ... other potential indications." Epithelial sodium channel blockers, such as P-552-02, are ... utilizing Parion's expertise in epithelial sodium channel blockers. Parion was founded based on ...

Novel Small Molecule Therapy Shows Benefit for Anemic Patients Via Hydration of Red Blood Cells

... suggested that a therapy designed to block this channel might have a beneficial effect on the progression of the disease. Senicapoc, a known Gardos channel blocker, works by limiting solute and water loss, ... provide further evidence that blocking the Gardos channel reduces dehydration of the sickle ...

Award-Winning Medicine Wheel Returns to the Cyclorama at the Boston Center for the Arts on Dec. 1 for 24-hour Vigil Recognizing World AIDS Day

... Water bearers from Fort Point channel to the Cyclorama mark 16th Annual 24-hour vigil ... copper buckets filled with water from Fort Point channel in South Boston into The Boston Center for the ... people will make short processions to Fort Point channel and back to the Boston Center for the Arts, where ...

Daiichi Sankyo and Forest Laboratories Finalize Contract for Co-Promotion of AZOR(TM)

... combination of two antihypertensives, the calcium channel blocker, amlodipine and the angiotensin receptor ... amlodipine, the number one prescribed calcium channel blocker (CCB) on the market, and olmesartan ... acute myocardial infarction on starting calcium channel blocker therapy. In studies of ACE inhibitors in ...

Essentialis Meets Primary Endpoint in Phase 2b Trial of DCCR for Treatment of Hypertriglyceridemia and is Granted Extensive Patent Coverage in the US

... of a US patent covering DCCR. The patent entitled "Salts of potassium ATP channel openers and uses thereof" contains claims to salts of diazoxide - ... DCCR, diazoxide choline controlled release, is an ATP-dependent potassium channel agonist with potential utility in several cardiovascular and metabolic ...

PTC Announces Data Showing That PTC124 Causes Statistically Significant Improvements in Chloride Channel Function in Cystic Fibrosis Patients

... drug PTC124 caused statistically significant improvements in the chloride channel function of children with cystic fibrosis (CF) caused by a particular ... protein. PTC124 also induced significantly improved CFTR-mediated chloride channel activity as measured by nasal potential difference, with 40 percent of ...

National Study Presented at ACG 2008 Confirms New Device Functions Like 'Rear-View Mirror' to Provide Improved View of the Colon

... Calif., this innovative new device is passed through the instrument channel of a standard colonoscope. As it emerges from the channel and extends beyond the tip of the colonoscope, the device automatically ...

Azor(TM) Reduces Blood Pressure in Difficult to Treat Special Populations

... or severity of angina or acute myocardial infarction on starting calcium channel blocker therapy or at the time of dosage increase. Congestive Heart Failure In general, calcium channel blockers should be used with caution in patients with heart failure. ...

Ranolazine Shortens QT Interval and Improves Cardiac Relaxation in Study of Patients With Genetic Sodium Channel Disorder

... called LQT3, which is caused by a genetic mutation in the late sodium channel and can be associated with heart rhythm problems, including sudden death. ... "Since individuals with LQT3 syndrome have a defect in the specific sodium channel where ranolazine has its activity, it makes sense that we are seeing ...

PTC Therapeutics Announces Publication of Preclinical Data in PNAS

... functional protein. Patients with CF lack the CFTR protein, a chloride channel that maintains proper hydration of epithelial cells in the lung, pancreas, ... to be delivered to the proper cellular location, and to induce chloride channel function. Collectively, these results indicate that this new approach may ...

ReachMD Broadcasts First-of-its-Kind Physician Peer-Peer Discussion on ENHANCE Trial

... through multiple channels throughout the day: -- Satellite Radio - XM channel 157, beginning at 1:30 p.m. EST -- Online Simulcast - ... information and communication to medical professionals. The ReachMD XM channel is a new and innovative media vehicle that continues to deliver on this ...

Lilly and Glenmark Pharmaceuticals Announce License Agreement

... 16% to 17% About TRPV1 TRPV1 is a member of the TRPV family of ion channel proteins. It is expressed in human pain pathways and in sensory neurons ... Research on TRPV1 supports the potential for antagonists of this ion channel to be effective in various pain conditions. The goal of the partnership is ...

Memory Pharmaceuticals Announces Results for Phase 2a Trial of MEM 1003 in Alzheimer's Disease

... placebo-controlled Phase 2a study of MEM 1003, a neuronal L-type calcium channel modulator, in Alzheimer's disease. The trial enrolled 183 subjects with ... the fourth quarter. About MEM 1003 MEM 1003 is a neuronal L-type calcium channel modulator that Memory Pharmaceuticals is developing for the treatment of ...

Sucampo Pharmaceuticals, Inc. Begins Pivotal Phase III Studies of Oral Lubiprostone to Treat Opioid-Induced Bowel Dysfunction (OBD)

... prescribed for chronic pain management. Lubiprostone, a chloride channel activator developed by Sucampo Pharmaceuticals, is currently approved for ... effects of these analgesics. Lubiprostone, as a locally acting chloride channel activator, is being studied to evaluate if it may directly counteract this ...

FDA Issues Complete Response Letter for INTUNIV(TM) (guanfacine) Extended Release for the Treatment of ADHD in Children and Adolescents

... Sci. 1997;18:211-219. 6. Wang M, Arnsten AF, Brennan A, et al. ÿ±2A-adrenoceptors strengthen working memory networks by inhibiting cAMP-HCN channel signaling in prefrontal cortex. Cell. 2007;129:397-410. 7. Arnsten AF, Li BM. Neurobiology of executive functions: catecholamine influences on ...

Cognition Therapeutics Closes Series A Financing to Advance Drug Candidates for Alzheimer's Disease

... Cognition Therapeutics was founded on small molecule chemical libraries licensed from co-founder Dr. Gilbert Rishton at California State University channel Islands and proprietary screening strategies established by co-founder and Chief Science Officer Dr. Susan Catalano. After initial investment and ...

Pivotal Data Show Bronchial Thermoplasty Can Improve Quality of Life and Reduce Asthma Attacks and Emergency Room Visits for Adults with Severe Asthma

... Delivered by the Alair System Bronchial thermoplasty is a non-drug procedure for asthma. The treatment is performed through the working channel of a standard flexible bronchoscope that is introduced through a patient's nose or mouth, and into their lungs. The tip of the small diameter ...

Ongoing Landmark ROADMAP Study Demonstrates Significant Improvement in Blood Pressure Control at One Year, According to Blinded Results

... of five years. Patients with hypertension were also treated at the investigator's discretion with diuretics, alpha- or beta-blockers or calcium channel antagonists to achieve a target BP of <130/80. Patients requiring treatment with an ARB or ACEi were withdrawn from the study. About the ...

Clinician Reports Fast Healing of Intractable Wounds Using MEDIHONEY(R)

... wide variety of common wounds, abrasions, and minor burns. As announced previously, these dressings are expected to be in the US retail distribution channel by 2010. Additional clinical abstracts on the use of MEDIHONEY presented at the SAWC include: Active Leptospermum ...

BARC Central Laboratory Joins Alzheimer's Association Research Roundtable

... dermatology and immunology. BARC performs more than 2,000 assays, including molecular diagnostics and genomics, and serves as a technology transfer channel by developing and clinically validating new laboratory tests on a global, multi-site GCP-certified platform for pharmaceutical and biotechnology ...

Advances in Science and Treatment of Pain Presented at 25th Annual American Academy of Pain Medicine Meeting January 28 - 31, 2009

... 10:00 AM HAST Coral Ballroom Foyer, Hilton Hawaiian Village Authors present Jan. 29 from 3:30-5 PM and Jan. 30 from 9-10 AM Calcium channel Blockers Compared for Neuropathic Pain, Poster 181 Addictive Qualities of Cannabinoid Medication, Poster 193 Tramadol Outcomes, Poster 197 ...

Vical Pandemic Influenza Vaccines Achieve T-Cell Responses and Cross-Clade Reactivity in Humans

... the H5 plasmid plus separate plasmids encoding consensus sequences of two highly conserved influenza virus proteins: nucleoprotein (NP) and ion channel protein (M2). The trivalent vaccine was designed to elicit a combination of T-cell and antibody responses against all three proteins. Both vaccines ...

Retigabine Significantly Reduces the Number of Seizures in Adults With Inadequately Controlled Partial-Onset Epilepsy

... doses of up to three AEDs. Retigabine has a different mechanism of action than currently approved AEDs. Retigabine is a neuronal potassium channel opener, which helps control neuronal excitability. In epilepsy patients, brain cells can become overly excited, disrupting normal brain activity and ...

New Data Show Efficacy of Zebinix(TM) in the Treatment of Epilepsy

... are triggered via voltage-gated sodium channels in the nerve cell membrane. About Zebinix(TM) Zebinix(TM) is a novel voltage-gated sodium channel blocker that has been designed to reduce the frequency of partial-onset seizures when used in combination with other anti-epileptic drugs. This ...

Stem Cell Regeneration Repairs Congenital Heart Defect

... heart failure in a series of genetically altered mice. Specifically, the "knockout" of a critical heart-protective protein known as the KATP channel compromised heart contractions and caused ventricular dilation or heart enlargement. The condition, including poor survival, is typical of patients ...

Southern Research Institute Wins $14.7 Million NIH Award to Participate in Molecular Libraries Probe Production Center Network

... Center for Chemical Probe Discovery and Optimization at Scripps Research Institute, Scripps Institute, San Diego, Calif. -- Johns Hopkins Ion channel Center, Johns Hopkins University, Baltimore, Md. -- NIH Chemical Genomics Center, NIH/NHGRI, Rockville, Md. -- University of Kansas Specialized ...

Vical Announces Breakthrough for Pandemic Influenza DNA Vaccines With Preliminary Human Data

... the H5 plasmid plus separate plasmids encoding consensus sequences of two highly conserved influenza virus proteins: nucleoprotein (NP) and ion channel protein (M2). The trivalent vaccine is designed to elicit a combination of T-cell and antibody responses against all three proteins. Both vaccines ...

Medarex Highlights Strength in Antibody Development and Underlying Pipeline Strategy at R&D Day Event in New York City

... candidates," said Nils Lonberg, Senior Vice President and Scientific Director at Medarex. "We are uniquely structured to identify, optimize and channel our most promising lead candidates into clinical development on a continual basis to ensure the future growth and value of our pipeline." ...

CV Therapeutics Announces Archives of Internal Medicine Publication of Study Showing 20 Percent of Heart Attack Patients in Premier Registry Experienced Angina at One Year

... or weekly angina attacks. The investigators reported that in patients with angina after one year, 87.9 percent were not taking calcium channel blockers, 30.8 percent were not taking beta blockers and 48.6 percent were not taking nitrates. "After patients survive a heart attack, a primary ...

Pivotal Pulmonary Arterial Hypertension Study Published in The Lancet Concludes That Bosentan (Tracleer(R)) Demonstrates Benefits in Patients With Mildly Symptomatic WHO Functional Class II Disease

... pulmonary arterial hypertension. NEJM 2002; 346: 896-903 (BREATHE-1). 4. Sitbon O, Humbert M, Jais X et al. Long-term response to calcium channel blockers in idiopathic pulmonary arterial hypertension. Circulation 2005; 111: 3105-3111 5. D'Alonzo GE, Barst RJ, Ayres SM et al. Survival in ...

HUYA Bioscience Int'l Announces Pre-IND Outcome for HBI-3000 - Promising Anti-Arrhythmia Compound Sourced From China

... significant unmet need. HUYA is proud to lead the way in co-developing new and important drugs that may save lives." HBI-3000 is a novel, multi-ion channel blocker for the treatment of atrial or ventricular arrhythmias. In April 2008, HUYA announced the completion of three Phase I protocol studies of ...

New Study Shows BENICAR(R) (olmesartan medoxomil) Reverses Blood Vessel Damage Independent of Blood Pressure Lowering

... 11. Schiffrin EL, Deng LY. Structure and function of resistance arteries of hypertensive patients treated with a beta-blocker or a calcium channel antagonist. J Hypertens 1996;14:1247-55 12. Schiffrin EL. Remodeling of resistance arteries in essential hypertension and effects of ...

JDSU WaveReady Receives Brocade Data Center Ready Status for Brocade-Based Storage Area Network (SAN) Infrastructures

... the reach of SANs. WaveReady multirate transponders support FC100 (1.0625 Gbps), FC200 (2.125 Gbps), FC400 (4.25 Gbps), and 10GFC (10.518 Gbps) Fibre channel interfaces and, combined with amplifiers, extend the reach of SAN services to over 175 Km. WaveReady offers a simple and reliable transport solution ...
Other Contentschloroplastschloroplastschordateschordatejumpingjumpingjumpingjumpingwalkwalkwalkwalkwalkwalkwalkwalkchyme
(Date:11/24/2009)...4, 2009) New research on bacterial communities th... predictable temporal patterns, suggesting that sc...r monitoring climate change in the polar regions. ... of the National Academy of Sciences Early Editio...ers shifted synchronously over time, correlating w...
(Date:11/23/2009)...sents strong evidence that the "synergistic" effec...elated pollution and indoor endotoxin causes more ...osure alone. , Environmental health scientists...edicine have shown that children exposed to both h... endotoxin during early life are six times more li...
(Date:11/23/2009)...mber 23, 2009 Applied mathematicians dissected th...ia ), a characteristic long leaf with a saddle-lik...the edges. The simple cause of the lily,s fan-like...ring differential growthwas revealed by using an e..., Haiyi Liang, a postdoctoral student at Harvard...
Breaking Biology News(10 mins):Researchers establish common seasonal pattern among bacterial communities in Arctic rivers 2Exposure to both traffic, indoor pollutants puts some kids at higher risk for asthma later 2The cause behind the characteristic shape of a long leaf revealed 2Health Care Training a Great Option for Back to School Career Seekers 56327 1Health Care Training a Great Option for Back to School Career Seekers 56327 2Pew Commissioned Poll Finds Nine in Ten Iowa Voters Support More Government Oversight of Food 56323 1Pew Commissioned Poll Finds Nine in Ten Iowa Voters Support More Government Oversight of Food 56323 2Pew Commissioned Poll Finds Nine in Ten Iowa Voters Support More Government Oversight of Food 56323 3Hissey Kientz LLP Urges Patients To Heed FDA Warning About Phospho soda Products 56320 1Hissey Kientz LLP Urges Patients To Heed FDA Warning About Phospho soda Products 56320 2Hissey Kientz LLP Urges Patients To Heed FDA Warning About Phospho soda Products 56320 3Hissey Kientz LLP Urges Patients To Heed FDA Warning About Phospho soda Products 56320 4
(Date:11/29/2009)...via,s Nanjing-based Service Delivery Center one of... Brno, Czech Republic (PRWEB) -- Mor...rovider, is pleased to announce its participation ...ld in Nanjing, China, on November 30, 2009. Moravi...panies that have established and grown a presence ...
(Date:11/29/2009)... Nov. 29 Acuo Technologies, develo...software, data migration tools and services, today... that allows image sharing across the networks of ...oShare solution is based on the versatile Acuo Tec...cuo AcuoShare enables secure access from various P...
(Date:11/29/2009)...itional healthcare,s uncertain future and rising c...ve care. Affordable Acupuncture Scottsdale answers...mber 29, 2009 -- Affordable Acupuncture, LLC opene...s been met with enthusiasm and gratitude. Its incr...ted to two things, need and cost. "As far as...
(Date:11/28/2009)...t spirits, recognize signs of depression , ...y seniors, the holiday season can trigger melancho...ith health issues or worry about money problems, a...To help overcome the seasonal blues, the AGS Found...ice: , Get out and socialize or invite family an...
(Date:11/27/2009)... 27 The Gymboree Corpora..., CFO/COO, will present at the NASDAQ OMX 23rd Inv...Hotel in London, England, on Wednesday, December 2...ve broadcast of The Gymboree Corporation,s present...oree.com, click on "Our Company" at the bottom of ...
Breaking Medicine News(10 mins):Health News:Moravia Worldwide to Participate in the 5th EU-China Business Summit 2009 in Nanjing China 2Health News:Acuo Technologies Announces a New Offering That Enables Sharing of Imaging Studies Securely and Affordably 2Health News:Affordable Acupuncture Greeted with Open Arms by Scottsdale and Phoenix Communities 2Health News:Seniors May Need Help Overcoming Holiday Blues 2
Other TagsAneurysmAneurysmOther Tagsteacher 2teacher 3dried 2dried 3fruits 2prolong 2