Navigation Links


Retinal in Medical Products

Super Quad® 160

Description:... providing a greater margin of safety during pan retinal photocoagulation. The SuperQuad® 160 is the ... of proliferative diabetic retinopathy, ischemic retinal vein occlusion and peripheral retinal holes and tears. Laser beam transmission and ...
Company:Volk Optical, Inc.

Eftiar Octane

Description:... of fibro-vascular proliferation and controlling retinal bleeding. Eftiar Octane and Eftiar Decalin ... of the retina during surgical treatment of a retinal detachment. In particular, EFTIAR may be used in the surgical management of : retinal detachment with giant tears ...
Company:Dutch Ophthalmic, USA

Perfluoron Liquid

Description:... capabilities. Perfluoron is ideal for managing retinal detachments complicated by proliferative vitreoretinopathy, giant retinal tears and trauma. Certified to be >99.9 ... clarity, which gives you an unobstructed view of retinal structures. Because Perfluoron is optically ...
Company:Alcon Laboratories

ReSeeVit CR-DGi Digital Imaging Sys Cmp

Description:... The ReSeeVit CR-DGi retinal Camera System is an easy-to-use digital video imaging system that captures retinal segment images for documentation, diagnosis and ... education. The package includes the Canon CR-DGi retinal camera for optimal performance. We also offer The ...
Company:Veatch Ophthalmic Instruments

optomap Retinal Examination

Description:... patients file. Optos core product is the retinal image produced by the Panoramic200 Scanning Laser Ophthalmoscope device: the optomap retinal image. The optomap retinal image gives eye-care professionals a much larger ...
Company:Optos North America

Retinal Acuity Meter, RAM

Description:... The retinal Acuity Meter (RAM) is the first visual ... that is clinically proven to accurately predict retinal ACUITY in eyes with glaucoma, cataract, and ... Delays in cataract surgery can be avoided when retinal acuity tests better than anticipated, and during ...
Company:AMA Optics, Inc.

STRATUS OCT Optical Coherence Tomography

Description:... evaluation in the detection of glaucoma and retinal diseases. The STRATUSOCT images and analyzes macular thickness, the retinal nerve fiber layer and the optic disc using the ... information provided by the STRATUSOCT produces retinal images never seen before. STRATUSOCT is a ...
Company:Carl Zeiss Meditec, Inc.

Retinal Acuity Meter, RAM®

Description:... hand-held potential vision tester measures retinal acuity in eyes with cataract, maculopathy, and ... vision testing requires two related tools, the retinal Acuity Meter or RAM (formerly known as the ... hand-held potential vision tester measures retinal acuity in eyes with cataract, maculopathy, and ...
Company:AMA Optics, Inc.

Direct Image 45° Prism SSV®

Description:... for midperipherical fundus pathologies and are recommended for tractional retinal detachments (PDR, BRVO etc.) and Rhegmatogenus retinal detachment. They can be used for panretinal photocoagulation and other ...
Company:Volk Optical, Inc.

Direct Image 30° Prism SSV®

Description:... for midperipherical fundus pathologies and are recommended for tractional retinal detachments (PDR, BRVO etc.) and Rhegmatogenus retinal detachment. They can be used for panretinal photocoagulation and other ...
Company:Volk Optical, Inc.

Direct Image 15 Prism

Description:... for midperipheral fundus pathologies and are recommended for tractional retinal detachments (PDR, BRVO etc.) and Rhegmatogenus retinal detachment. They can be used for panretinal photocoagulation and other ...
Company:Volk Optical, Inc.

Direct Image 45 Prism

Description:... for midperipheral fundus pathologies and are recommended for tractional retinal detachments (PDR, BRVO etc.) and Rhegmatogenus retinal detachment. They can be used for panretinal photocoagulation and other ...
Company:Volk Optical, Inc.

Direct Image 30 Prism

Description:... for midperipheral fundus pathologies and are recommended for tractional retinal detachments (PDR, BRVO etc.) and Rhegmatogenus retinal detachment. They can be used for panretinal photocoagulation and other ...
Company:Volk Optical, Inc.

Direct Image 15° Prism SSV®

Description:... for midperipherical fundus pathologies and are recommended for tractional retinal detachments (PDR, BRVO etc.) and Rhegmatogenus retinal detachment. They can be used for panretinal photocoagulation and other ...
Company:Volk Optical, Inc.

Central Retinal (ACS)

Description:... With somewhat higher magnification and increased stereopsis, the Central retinal ACS is best suited for detailed visualization to the equatorial regions. The Central retinal is ideal for vitrectomy in diabetics and in membrane peeling in ...
Company:Volk Optical, Inc.

Mini Quad® (ACS)

Description:... coaxial positioning of the lens on the eye. It is excellent for retinal detachment surgery, repairing giant retinal tears, diagnosing and treating anterior proliferative vitreoretinopathy ...
Company:Volk Optical, Inc.

clariVit Wide Angle

Description:... over a wide field allowing visualization of the entire retina, detailed retinal detachment surgery, treating retinal tears, diagnosis and treatment of anteriorproliferative vitreoretinopathy, ...
Company:Volk Optical, Inc.

Central Retinal

Description:... With somewhat higher magnification and increased stereopsis, the Central retinal is best suited for detailed visualization to the equatorial regions. The Central retinal is ideal for vitrectomy in diabetics and in membrane peeling in ...
Company:Volk Optical, Inc.

Mini Quad®

Description:... coaxial positioning of the lens on the eye. It is excellent for retinal detachment surgery, repairing giant retinal tears, diagnosing and treating anterior proliferative vitreoretinopathy ...
Company:Volk Optical, Inc.

Area Centralis®

Description:... subretinal neovascularization and changes from macular degeneration, retinal vascular occlusions, diabetic macular edema, proliferative diabetic retinopathy and other retinal conditions. It is ideal for focal laser treatment of these conditions ...
Company:Volk Optical, Inc.

TRC-NW200 Non-Mydriatic Retinal Camera

Description:... The new TRC-NW200 Non-Mydriatic retinal Camera combines Topcons years of experience in retinal imaging with the latest advances in digital and electronic ....
Company:Topcon America Corporation

Multicolor Laser Photocoagulator MC-300

Description:... as age-related macular degeneration, glaucoma, diabetic retinopathy and retinal diseases to meet all the clinical needs of retinal ....
Company:NIDEK, Inc.

EPIC-4000

Description:... requirements for the ISCEV ERG and EOG protocols. Testing the localized retinal response is also possible with the addition of LKCs Multi-Focal ERG package to the EPIC-4000. In only a few short minutes, a 3 dimensional "map of retinal function is ....
Company:LKC Technologies, Inc.

ARIS Automated Retinal Imaging System

Description:... allows eye care professionals to screen and diagnose sight-threatening retinal diseases in more patients in less time and at lower cost . As ... hard for you as possible. FDA approved , the ARIS is the most advanced retinal imaging system on the market ...
Company:Visual Pathways, Inc.

Khosla Cryo Ultra

Description:... Lightweight probe tips have high conductivity silver. Useful for Cataract, retinal Detachment, Glaucoma and Intra-vitreal surgery. Includes either one cataract probe or retinal ....
Company:Khosla Medical & Surgical, Inc.

Khosla Cyro Regular

Description:... Lightweight probe tips have high conductivity silver. Useful for Cataract, retinal Detachment, Glaucoma and Intra-vitreal surgery. Includes either one cataract probe or retinal ....
Company:Khosla Medical & Surgical, Inc.

Khosla Cryo Slim Model

Description:... Lightweight probe tips have high conductivity silver. Useful for Cataract, retinal Detachment, Glaucoma and Intra-vitreal surgery. Includes either one cataract probe or retinal ....
Company:Khosla Medical & Surgical, Inc.

RTA

Description:... glaucoma, diabetic retinopathy, age-related macular degeneration and other retinal pathologies. The RTA is the only system in the market that covers the ... only system to combine high resolution fundus imaging with quantitative retinal thickness ....
Company:Talia Technology Ltd.

TRC-NW100

Description:... A crisp 2.3 million pixel image provides excellent details of the retinal surface for all types of diagnostic requirements from disc evaluation for ... filmless, instant review, digital filing and digital referral of color retinal ....
Company:Topcon America Corporation

PAM

Description:... Simple testing performed in a few minutes. Rapid vision screening for retinal patients. retinal vision testing without refraction in post-surgical ....
Company:Marco Ophthalmic, Inc.

SL-40 Di Digital Still/Video Slit Lamp

Description:... and viewing software, this is a complete anterior segment system, and when used with the Volk 1.0x Digital Volk Lens a versatile and powerful retinal imaging ....
Company:Keeler Instruments Inc.

RTVue-100 Fourier-Domain Optical Coherence Tomography (OCT)

Description:... just emerging from clinical research in the last two years. The ultra-high speed and high resolution features enable the FD-OCT to visualize the retinal tissue with ultra-high clarity in a fraction of ....
Company:Optovue Corporation

KOWA Genesis-D Handheld Digital Retinal Camera

Description:... Handheld Digital retinal ...
Company:Kowa Optimed, Inc

ophthalmicsuiteASC Ambulatory Surgery Software

Description:... ophthalmicsuite product. The ASC module is a management system which can be used in ophthalmic surgical specialty. Cataract, cosmetic, strabismus, retinal surgeries are supported through the module. The ASC forms are adapted to your current paper charts. They are supported on tablet PC technology ...
Company:Medflow Inc.

G-3 goniofundus

Description:... angled at 76°, 66° and 60°. The G-3 is ideal for anterior chamber as well as central and peripheral fundus viewing and treatment. The retinal viewing mirrors are accurately angled and spaced 120° apart to eliminate "gaps" in the visualized fundus. The central portion of the lens also ...
Company:Volk Optical, Inc.

G-1 trabeculum

Description:... of the anterior chamber angle while the central portion of the lens can be used to view the posterior pole for signs of glaucoma and other central retinal maladies. The extended housing is optimized for static or dynamic gonioscopy - reducing fatigue and promoting rotation on the globe with minimal ...
Company:Volk Optical, Inc.

3 Mirror

Description:... angled at 76°, 66° and 60°. The 3 Mirror is ideal for anterior chamber as well central and peripheral fundus viewing and treatment. The retinal viewing mirrors are accurately angled to eliminate gaps in the visualized fundus. The central portion of the lens also provides direct observation of ...
Company:Volk Optical, Inc.

Disposable Vitrectomy Lens

Description:... Disposable SSV® Vitrectomy Lenses are a family of single-use direct view vitrectomy lenses used to enable a view of a particular region of the retinal surface during eye surgery. The contact lens element weighs less than 1 gram and is formed and polished to interface effectively with the typical ...
Company:Volk Optical, Inc.

TransEquator®

Description:... is designed for focal laser therapy and mid-to-far peripheral fundus diagnosis. Its unique optical design presents a realistic contour of the retinal concavity, offering an impressive wide-field view of the entire posterior pole extending to the equator. The superior optics of this lens allows ...
Company:Volk Optical, Inc.

QuadrAspheric®

Description:... wide field fundus laser lens. Its sleek 28.6mm diameter housing provides a definite advantage over competitive wide field lenses for peripheral retinal viewing, reflection displacement, and ease of use. This lens is excellent for small pupil fundus examination and as a general diagnostic / laser lens ...
Company:Volk Optical, Inc.
Other Contentsmicrocephalymidwifemidwifeheadachesheadachesheadachesheadachesheadachesmigrainesmigrainesmigrainesmilia
(Date:11/24/2009)...el action of a remarkable class of ring-shaped pro... the Lawrence Berkeley National Laboratory (Berkel...graphy beamline at the Advanced Light Source (ALS)...expression and replication, and are vital to the s...ious agents, such as the human papillomavirus, whi...
(Date:11/24/2009)... (November 24, 2009) New research on bacterial co...tems reveals predictable temporal patterns, sugges...s markers for monitoring climate change in the pol... Proceedings of the National Academy of Sciences ... the six rivers shifted synchronously over time, c...
(Date:11/23/2009)...ember 23, 2009 - The time of day matters to forest...per produced by a research team led by Professor M...,s vice-principal for research and colleagues in t...t. George campus. , Capitalizing on their prev... the research team examined how poplar trees use t...
Breaking Biology News(10 mins):Atomic-level snapshot catches protein motor in action 2Atomic-level snapshot catches protein motor in action 3Atomic-level snapshot catches protein motor in action 4Researchers establish common seasonal pattern among bacterial communities in Arctic rivers 2Time of day matters to thirsty trees, U of T researcher discovers 2Combo Treatment May Ease Depression After Stroke 53891 1Combo Treatment May Ease Depression After Stroke 53891 2Stroke Doubles Risk of Hip Thigh Fractures 53889 1Stroke Doubles Risk of Hip Thigh Fractures 53889 2Stroke Doubles Risk of Hip Thigh Fractures 53889 3Carnegie donates landmark clones to biology 9509 1Carnegie donates landmark clones to biology 9509 2
(Date:11/25/2009)....25/PRNewswire/-SentinelleMedicalInc.,aleadingmanu...ftwarelaunchesasuiteofnewleadingedgeclinicalapplic...atthisyear,sRadiologicalSocietyofNorthAmerica(RSNA...0,HallA).Theapplicationsleveragetheuniquehighquali...ngcoilsandsupportmultipleimagingmodalitiesformulti...
(Date:11/25/2009)...icalEndorsements,Business,andPressJoinEfforttoEduc...ire/--Onceagain,theNationalBipolarFoundationandthe...heir"Safe,tilStable"program,whichisnowbeingwidelya...order.Today,theNationalBipolarFoundationreceivedap...ailfromtheLt.GovernorofLouisianaMitchLandrieu.TheN...
(Date:11/25/2009)... period was too short to draw definite conclusions...HealthDay News) -- In diabetic patients with block...rence in outcomes at one year whether patients und...British researchers report. , Bypass surgery ha...s with coronary artery disease. However, less inva...
(Date:11/25/2009)...te, CDC sees few signs of trouble with the H1N1 va...y News) -- The ongoing H1N1 swine flu pandemic may... among younger patients, a U.S. health official sa...erious pneumococcal infections around the country,...er for Immunization and Respiratory Diseases at th...
(Date:11/25/2009)...eat colorectal cancer also can reverse a rare stom...herapy for the disease, researchers at Vanderbilt ...rier,s disease causes thickening of the stomach li...as well as anemia and swelling in the feet and ank... risk for gastric cancer. Previously, the only eff...
Breaking Medicine News(10 mins):Health News:Sentinelle Medical Launches Aegis Suite of Oncology 4D Visualization Software with PureWeb(TM) Technology 2Health News:Sentinelle Medical Launches Aegis Suite of Oncology 4D Visualization Software with PureWeb(TM) Technology 3Health News:First Time-Door is Open for Family Discussion of Bipolar Disorder 2Health News:First Time-Door is Open for Family Discussion of Bipolar Disorder 3Health News:Stenting May Equal Bypass for Diabetic Heart Patients 2Health News:Stenting May Equal Bypass for Diabetic Heart Patients 3Health News:Swine Flu Tied to Rise in Pneumonias Among Young 2Health News:Swine Flu Tied to Rise in Pneumonias Among Young 3Health News:Swine Flu Tied to Rise in Pneumonias Among Young 4Health News:Vanderbilt scientists report first effective medical therapy for rare stomach disorder 2
Other TagsplayersSolomonfilmfilmfilmfilmhonorhonorassistsforecastOther Tagsrhesus 2nature 2nature 3nature 4nature 5nature 6nature 7nature 8nature 9nature 10