Navigation Links


Molecular in Medical News

Carnegie Mellon develops innovative method to detect genetic causes of complex diseases

... which are characterized by multiple clinical and molecular traits. Rather than searching one at a time for ... profiling can identify tens of thousands of molecular traits associated with the disease." Typically, ... will provide a more comprehensive genetic and molecular view of complex diseases," Xing said, "so we can ...

Scientists Bioengineer New Teeth in Mice

... chairman of the Department of Biochemistry and molecular Biology at the University of Miami Miller School ... M.D., Ph.D., researcher and assistant professor, molecular and cellular medicine, Institute for Regenerative ... interim chairman, Department of Biochemistry and molecular Biology, University of Miami Miller School of ...

Researchers Identify New Method to Selectively Kill Metastatic Melanoma Cells

... Spain, found that activation of a specific molecular pathway triggers melanoma cells to begin a ... was led by Soengas, with the Melanoma Laboratory, molecular Pathology Program, Spanish National Cancer ... and chair of the Department of Human and molecular Genetics , and director of the VCU Institute ...

Addario Lung Cancer Medical Institute Announces Diagnostic Screening and Clinical Research Collaborations With Response Genetics, Inc.

... with Response Genetics, Inc. (Nasdaq: RGDX ) on molecular diagnostic testing and banking of advanced-stage ... ) Specific molecular features of tumors, including EGFR mutations, ras ... advanced stage disease, are having these molecular assessments performed. As a result of ALCMI's ...

Cepheid Reports 2009 Second Quarter Results

... Calif., Cepheid (Nasdaq: CPHD ) is an on-demand molecular diagnostics company that develops, manufactures, ... proprietary test cartridges. Through its strong molecular biology capabilities, the company is focusing on those applications where rapid molecular testing is particularly important, such as ...

Bolli Becomes New Editor-In-Chief of Circulation Research

... Medicine and director of the Institute of molecular Cardiology at the University of Louisville in ... research from fields including cellular biology, molecular biology and molecular genetics, as well as biochemistry, biophysics, ...

Studies Show Genetic Activity of Antioxidants

... researchers have begun to discover the exact molecular reasons why foods such as turmeric -- a popular ... modified by exposure to curcumin." The molecular study was done with mouse genes, and was preceded ... that eventually can block blood vessels. The molecular study was preceded by a trial in which mice given ...

Study aims to induce recovery from ankylosing spondylitis

... in a clinical trial that aims to merge the latest molecular discoveries published by the California ... medicine. The treatment protocol is based on a molecular understanding of the interaction of intracellular ... years. These trials are aimed at moving the molecular discovery known as the Marshall Protocol as ...

Enigma Diagnostics Announces Signing of Patent Licenses With Roche Molecular Systems, Inc.

... Limited, the decentralized and point-of-care molecular diagnostics company, announced today that it has signed two patent license agreements with Roche molecular Systems, Inc. (RMS). The licenses signed ... enabling fast and accurate 'test and treat' molecular diagnostics at point-of-care. Financial ...

New Map of Genomic Variation Will Enable Disease Research

... said study co-leader Peter S. White, Ph.D., a molecular geneticist and director of the Center for ... CNVs," said lead author Tamim H. Shaikh, Ph.D., a molecular geneticist at Children's Hospital. Often puzzling ... the database may also assist researchers studying molecular evolution, for example, those investigating how ...

Abbott Reports Strong Second Quarter Results; Confirms Double-Digit Earnings Growth Outlook for 2009

... $265 n/m n/m n/m molecular Diagnostics $73 20.6 (9.6) ... $310 n/m n/m n/m molecular Diagnostics $140 20.4 (8.6) ... and continued double-digit growth in Abbott's molecular diagnostics business. Vascular sales ...

Six Researchers to Receive Prestigious Awards from the American Society of Hematology

... clinically distinct lymphoma subtypes and molecular predictors of survival. He further showed that each molecular subtype of cancer has its own "Achilles heel," ... This year's lecture will be on the impact of molecular genetic studies of globin genes on the diagnosis ...

2009 recipient of minority scholar award begins clinical research on leukemia

... His research is entitled "Unraveling the molecular Pathogenesis of T-Cell Acute Lymphoblastic ... of the zebrafish model system to unravel the molecular pathogenesis of T-cell acute lymphoblastic ... Gutierrez is interested in identifying targetable molecular pathways that are required for the survival of ...

Cepheid Receives FDA Clearance for First On-Demand Molecular Diagnostic Test for Clostridium difficile Infection

... its Xpert(R) C. difficile test, an on-demand molecular diagnostic test designed for 45-minute detection ... to $51.5 million per day. "As the leader in molecular HAI testing, it is incumbent for Cepheid to ... represents a paradigm shift in the automation of molecular analysis, producing accurate results in a timely ...

Two Fred Hutchinson Cancer Research Center Scientists Receive Presidential Early Career Award

... in Mumbai. He completed his doctoral work in molecular evolutionary biology at the University of ... her work focuses on integrating genetic and molecular methods to better understand the role selenium, ... one aspect of Peters' research. Incorporating molecular and genetic approaches, she also studies vitamin ...

New role discovered for molecule important in development of the pancreas

... endocrine progenitor cells. Further molecular characterization of these mutant mice led the ... its expression; it does this by forming a molecular complex with the protein Hnf6, which is mediated ... implications of the findings also suggest a molecular mechanism for why those individuals who harbor ...

New strategies to improve treatment and ultimately prevent heart failure in children

... to develop an understanding of the cellular and molecular mechanisms underlying the genesis of congenital ... defects, and to develop an understanding of the molecular processes that negatively impact upon heart ... are gaining a greater understanding of the molecular and genetic mechanisms of noncompaction of the ...

UT Southwestern researcher named HHMI Early Career Physician-Scientist

... Dr. Russell DeBose-Boyd, associate professor of molecular genetics, was appointed an HHMI Early Career ... They are Dr. Zhijian "James" Chen, professor of molecular biology; Dr. Johann Deisenhofer, professor of ... Dr. Masashi Yanagisawa, professor of molecular genetics; and Dr. Hongtao Yu, professor of ...

Cell Pathway May Be Key to Lung Cancer's Spread

... Sendurai A. Mani, an assistant professor of molecular pathology at the University of Texas M.D. ... time demonstrates that lung cancer acquires the molecular traits necessary to metastasize early on by ... Mani, Ph.D., assistant professor, Department of molecular Pathology, University of Texas M.D. Anderson ...

Damon Runyon Cancer Research Foundation awards $2.7M to 7 top young clinical investigators

... of disease subtypes that develop along distinct molecular pathways. Dr. Miller aims to use comparative ... drug development, and 3) to define the molecular changes in GBM after standard-of-care therapy. ... of clinical trials for patients with specific molecular subtypes of GBM. Dr. Miller works under the ...

News from the Latest Issue of Molecular Medicine Kicking The Habit - It's In The Genes

... is published by The Feinstein Institute for molecular Research. The peer-reviewed journal strives to ... body functioning and disease pathogenesis at the molecular level, which may allow researchers and ... to use that knowledge in the design of specific molecular tools for disease diagnosis, treatment, ...

UGA researchers achieve breakthrough in effort to develop tiny biological fuel cells

... have developed a successful way to grow molecular wire brushes that conduct electrical charges, a ... to metal surfaces as ultra-thin films. "The molecular wires are actually polymer chains that have been ... site to electrode," he said. "Hopefully our molecular wires will provide a better conduit for charges ...

Cepheid Announces European Release of Improved Test for BCR-ABL Chromosomal Translocation Associated With Chronic Myelogenous Leukemia (CML)

... System, the world's leading on-demand molecular diagnostic platform. "The GeneXpert System ... of producing unheard of sensitivity levels for a molecular system - a potential key benefit in monitoring ... possible only within a fully closed integrated molecular sample prep/test system. We will continue to ...

Association for Molecular Pathology comments to the SACGHS

... Health and Society (SACGHS), the Association for molecular Pathology (AMP) addressed three areas: ... include a panel of expert stakeholders with molecular diagnostics experience. AMP urges that funding ... designed comparative effectiveness trials for molecular tests be coupled with funding for comparative ...

AMP urges inclusion of molecular diagnostic tests in comparative effectiveness research

... DC June 12, 2009 -- The Association for molecular Pathology (AMP) today released the text of a ... to train experts in diagnostics (including molecular diagnostics) in current health services research ... and scientists, including laboratorians with molecular diagnostics expertise, economists, and ...

Enigma Diagnostics Announces Patent On Real-Time Monitoring of Amplification Reactions Upheld In Entirety Following Opposition From BD at European Patent Office

... Limited, the decentralised and point-of-care molecular diagnostics company, announced today it was ... The system may be applied to a wide variety of molecular diagnostic applications including the rapid ... in developing the next generation of rapid molecular diagnostic instrument platforms for decentralised ...

Clarient Launches New Gene Mutation Test to Help Select Therapy for Non-Small Cell Lung Cancer

... CLRT ), a premier anatomic pathology and molecular testing services resource for pathologists, ... EGFR mutation test can be used as a predictive molecular biomarker to explain why a subset of patients ... of therapy. In addition to EGFR mutations, other molecular markers have also been cited to predict patient ...

Symbia.net - Hotspot for Remote Access

... to support larger image datasets derived from molecular imaging technologies," said Michael Reitermann, chief executive officer, molecular Imaging, Siemens Healthcare. "As clinical utilization for molecular imaging procedures increases, a client server ...

Siemens Makes Innovation Accessible with Comprehensive Molecular Imaging Solutions

... Customer-focused solutions in molecular imaging offer greater long-term value ... United States and internationally, Siemens molecular imaging solutions offer options at all purchasing ... The Biograph (TM) mCT, the world's first molecular CT, will be shown at SNM for the first time. ...

MDS Nordion Begins to Manufacture Cardiac Imaging Agent

... flow. "There is growing interest in advanced molecular imaging technologies to help better diagnose and ... a global leader in providing medical isotopes for molecular and diagnostic imaging, radiotherapeutics, and ... contract research, medical isotopes for molecular imaging, radiotherapeutics, and analytical ...

New accurate diagnostic test for swine H1N1 influenza using RT-PCR technology

... equipment. This timely and broadly applicable molecular technique is described in an article published ... implemented in clinical testing laboratories. The molecular strategy described in the article in ... of the report entitled "A Simple Method for molecular Detection of Swine-Origin and Human-Origin ...

Cepheid Announces Symposium Program for 2009 Association for Professionals in Infection Control (APIC) Annual Conference

... 10th. Cepheid's GeneXpert(R) Systems and menu of molecular diagnostic tests will be on display in booth #906 ... Calif., Cepheid (Nasdaq: CPHD ) is an on-demand molecular diagnostics company that develops, manufactures, ... proprietary test cartridges. Through its strong molecular biology capabilities, the company is focusing on ...

Gene Network Sciences Announces Cancer Collaboration with University of Connecticut Health Center's Neag Comprehensive Cancer Center

... named. "With ever-increasing quantities of molecular and genetic data from cancer patients becoming ... in biosimulation with its ability to derive molecular mechanisms of drugs and diseases directly from molecular profiling and clinical data. Based in Cambridge, ...

Cepheid Receives Health Canada License for Xpert(R) HemosIL(R) FII & FV Test

... Thrombosis Improves Time-to-Result over Current molecular Tests SUNNYVALE, Calif. and BEDFORD, Mass., ... test. "Given the complexity of traditional molecular diagnostics, clinical laboratories currently may ... the aid of both classic coagulation assays and molecular tests. In the past, many of ...

I-SPY trial offers key insights into locally advanced breast cancer

... "We need to develop a better understanding of the molecular signatures of these tumors. Understanding their ... the I SPY trial, scientists determined that the molecular profiles of locally advanced breast cancer tumors ... the identification of drugs targeting the molecular profiles of aggressive breast cancers, and to ...

Exagen Launches New Diagnostic Assays for Bowel Disease at Digestive Disease Week Conference

... Newkirk, Ph.D., CLSp (MB), Executive Director of molecular Diagnostics at CRL. "We welcome the opportunity ... Inc. Exagen Diagnostics is a CLIA-registered molecular diagnostics laboratory with a growing menu of ... testing services in the areas of Clinical Trials, molecular Diagnostics, Insurance, and Toxicology. CRL is ...

MDS Nordion Opens New Radiopharmaceutical Production Facility in Belgium

... medical isotopes and radiopharmaceuticals used in molecular medicine, today announced the opening of a ... a global leader in providing medical isotopes for molecular and diagnostic imaging, radiotherapeutics and ... contract research, medical isotopes for molecular imaging, radiotherapeutics, and analytical ...

Stand Up to Cancer awards $73.6 million for novel, groundbreaking cancer research

... Professor of Urology and Biochemistry & molecular Biology, University of Southern California; ... Center; "An Integrated Approach to Targeting molecular Breast Cancer molecular Subtypes and Their "Resistance" Phenotypes" / ...

Berkeley Lab scientist co-leads breast cancer 'dream team'

... with the goal of matching a tumor's genetic and molecular profile with the therapy that has the best chance ... significant progress in our understanding of the molecular basis of cancer. We know now that breast cancer ... great strides in learning what goes wrong at the molecular and genomic level in different types of cancers. ...

DFG establishes nine new collaborative research centers

... there is still much to be learned on the exact molecular processes that cause tumour microenvironments to ... cancer cells and their microenvironment on a molecular level. At the forefront will be the research of molecular modifications in the architecture, ...
Other Contentsmicrocephalymidwifemidwifeheadachesheadachesheadachesheadachesheadachesmigrainesmigrainesmigrainesmilia
(Date:11/24/2009)...ystallised a protein that may help gut bacteria bi...d be used by probiotic producers to identify strai.... , "Probiotics need to interact with cells linin... attach to surfaces in the gut they are more likel...ity," says Dr Nathalie Juge from the Institute of ...
(Date:11/24/2009)...W YORK (November 24, 2009) -- The Wildlife Conserv...ling that the last remaining population of Siberia...the rising tide of poaching and habitat loss. , ...ussian officials of what needs to be done to prote...t. , The report was released by the...
(Date:11/24/2009)...vailable in Spanish . , The presence of inc...flammatory substances in the blood, hinders the lo...esearch project of the University of Navarra condu...he School of Pharmacy. , The project, entitled "...to the control of body weight and inflammation," e...
Breaking Biology News(10 mins):A sticky solution for identifying effective probiotics 2Report shows dramatic decline in Siberian tigers 2It can be predicted the reaction obese patients will have to a diet 2Enzyme doesnt act alone in atrial fibrillation 8877 1Enzyme doesnt act alone in atrial fibrillation 8877 2The bitter side of sweeteners 8874 1The bitter side of sweeteners 8874 2BenefitMall Hosts New World of Healthcare Forum to Empower Partners to Find Solutions for Volatile Healthcare Industry 49218 1BenefitMall Hosts New World of Healthcare Forum to Empower Partners to Find Solutions for Volatile Healthcare Industry 49218 2BenefitMall Hosts New World of Healthcare Forum to Empower Partners to Find Solutions for Volatile Healthcare Industry 49218 3
(Date:11/25/2009)...ire-USNewswire/--WhenmostpeopleheartheacronymTMJ,t...patientsthehelptheyneed.TMJstandsfortheTemporal-Ma...s/connectswithyourskull(temporalbone). ,, Themo...nwithchewing,clickingorpoppingofthejaw.Butmanyothe...adaches,fatigue,sleepdisturbances,irritability,alo...
(Date:11/25/2009)...-SentinelleMedicalInc.,aleadingmanufacturerofbreas...suiteofnewleadingedgeclinicalapplicationsonitsAegi...iologicalSocietyofNorthAmerica(RSNA)annualmeetingi...licationsleveragetheuniquehighqualityimagesgenerat...rtmultipleimagingmodalitiesformulti-parametricasse...
(Date:11/25/2009)...wire/--TheBayAreaAirQualityManagementDistrictisiss... Alert forThursday,November26,2009whichbansbu...bothindoorsandoutdoors. ,, "Cold,stillweatherwi...kBroadbent,executiveofficeroftheAirDistrict."We,re...ghborsandfellowcommunitymembersthisThanksgiving,an...
(Date:11/25/2009)...ew out of a collaboration between UCLA engineers a...nearly 10 million Americans who suffer from periph...ning of the arteries, peripheral arterial disease,...narrowed arteries reduce blood flow to the limbs. ...r disease, heart attack and stroke, and its progre...
(Date:11/25/2009)...on and treatment clinics to resume Monday, Nov. 30...mber 25, 2009 -- Centegra Health System is continu...shots at four Centegra Primary Care (CPC) vaccinat...arrived. The clinics are at CPC sites in Huntley, ...en as follows: ,   From 4:30 to 7:30 p...
Breaking Medicine News(10 mins):Health News:Sentinelle Medical Launches Aegis Suite of Oncology 4D Visualization Software with PureWeb(TM) Technology 2Health News:Sentinelle Medical Launches Aegis Suite of Oncology 4D Visualization Software with PureWeb(TM) Technology 3Health News:Winter Spare the Air Alert in Effect for Thursday, November 26, 2009 2Health News:Engineers, doctors at UCLA develop novel material that could help fight arterial disease 2Health News:Engineers, doctors at UCLA develop novel material that could help fight arterial disease 3Health News:Engineers, doctors at UCLA develop novel material that could help fight arterial disease 4Health News:Centegra H1N1 Vaccination Clinics to Resume Tuesday, Dec. 1 2Health News:Centegra H1N1 Vaccination Clinics to Resume Tuesday, Dec. 1 3Health News:Centegra H1N1 Vaccination Clinics to Resume Tuesday, Dec. 1 4
Other TagsplayersSolomonfilmfilmfilmfilmhonorhonorassistsforecastOther Tagsrhesus 2nature 2nature 3nature 4nature 5nature 6nature 7nature 8nature 9nature 10