Navigation Links


Function in Medical News

'Safe' Ozone Levels May Not Be for Some

... standards can have a negative effect on lung function in healthy people, say U.S. researchers. The ... Society. He and his colleagues studied lung function in 31 healthy nonsmokers who were exposed to ... They found that significant decreases in lung function and respiratory symptoms occurred at ozone ...

Male Fertility Supplement Improves Sperm Quality & Motility in Clinical Study

... on recent studies showing improvements in sperm function following supplementation of men with various ... to determine the impact of FertilAid on sperm function for men with "abnormal sperm ... able to cause fertilization. In evaluating sperm function in humans, "total normal sperm ...

Even healthy lungs labor at acceptable ozone levels

... threshold for decrements in ozone-induced lung function in healthy young subjects is below this ... above and below the new standard induce lung function decrements and to further study the time-course ... the third and fourth bouts of exercise. Lung function for each subject was assessed before, during and ...

Study in this Week's Issue of Cell Finds Injected Growth Factor Spurs Heart Regeneration

... enhances heart regeneration, improves heart function without need for cardiac stem cells ... spur heart-muscle growth and recovery of cardiac function when injected systemically into animals after a ... heart regeneration was increased and pumping function (ejection fraction, assessed on echocardiograms) ...

Injection May Heal Damaged Heart

... In mouse study, injured tissue and coronary function are restored THURSDAY, JULY 23 ... fuel heart-muscle growth and recovery of cardiac function when injected after a heart attack. This is a ... heart regeneration increased and the pumping function improved, compared with untreated mice. In ...

Scientists locate disease switches

... Acetylation is essential for cells' ability to function normally. Defective protein regulation plays a ... have much greater consequences for the organism's function than previously thought. In one example, the function of Cdc28, an important growth protein in yeast, ...

Healthy Diet, Exercise Keeps Mind Sharp As You Age

... That's the recipe for preserving cognitive function as you age, according to four new studies that ... were sedentary had the lowest level of cognitive function at the start and higher rates of decline over the ... Tierney said. "The worst groups [on cognitive function tests] were the ones highest in strenuous and ...

Wyeth Consumer Healthcare Announces the Availability of New Centrum Ultra Line of Multivitamins Specially Formulated For Women and Men

... C, E, selenium and zinc to help support immune function .* About Centrum Ultra Men's ... C, E, selenium and zinc to help support immune function .* B vitamins to help unlock energy .* ... iron, selenium and zinc to help support immune function .* About Centrum Silver Ultra ...

A 'Heart Healthy' Diet and Ongoing, Moderate Physical Activity May Protect Against Cognitive Decline as We Age

... questionnaire and cognitive assessment. Cognitive function was checked again during four assessments over 11 ... in levels of both physical activity and cognitive function over seven years in 3,075 white and black elders ... decreasing, or increasing/fluctuating. Cognitive function was assessed using the 3MS. The ...

Possible Gene Regions for Schizophrenia Located

... Immune function genes also in the same area, researchers say ... WEDNESDAY, July 1 (HealthDay News) -- Immune function may play a role in schizophrenia, say scientists ... director of the Program on the Genetics of Brain function at Stanford University School of Medicine, said ...

IU researchers find vibrator use to be common, linked to sexual health

... use is associated with more positive sexual function and being more proactive in caring for one's ... use is common, it's linked to positive sexual function such as desire and ease of orgasm, and it's ... positively related to several aspects of sexual function (desire, arousal, lubrication, orgasm, pain and ...

Soy in the Diet May Protect Lung Function

... foods such as tofu and soy milk may improve lung function and lower the chances of developing chronic ... of soy products is associated with better lung function and reduced risk of COPD. Long-term smoking ... is characterized by a progressive decline in lung function and includes chronic bronchitis and emphysema, ...

Veterans Affairs Researchers Study Benefits of Robot for Ankle Rehabilitation

... current therapies for improving gait and balance function after stroke. "Gait problems due to ... achieve improvement in their gait and balance function via ankle robot-assisted therapy. Using a ... (as-needed), significantly improves walking function and ankle motor control recovery as well as ...

Slow Decline Often Follows Stroke Recovery

... the first time. The researchers rated people's function over time, assessing their ability to carry out ... status also had a significant effect on whether function deteriorated over time, Dhamoon said. "Uninsured ... covered by Medicaid had a significant decline in function over five years, while those covered by Medicare ...

Cell Protein Could Help Spur Malignancy

... the possibility that inhibiting the mitochondrial function of STAT3 could be a promising cancer therapy in ... medical school. "By knowing this mitochondrial function is critical, it may be possible to design therapeutic strategies that specifically target this function while sparing the other functions of the protein, ...

Migraine With Aura May Lead to Brain Lesions

... Whether damage in women affects function remains unclear, researchers say ... these small areas of damaged brain tissue affect function or cognition, however, remains unknown, the ... think these brain lesions definitely affect the function of the brain to some extent, and the more you ...

Social Activity Keeps Elders Young, Agile

... be increasing their risk for declining motor function and hastening their death, researchers from Rush ... of the study, they found. This decline in motor function was also linked with a more than 40-percent ... between socialization and decline in motor function remained even after taking into account factors ...

Mayo Genomic Discovery: Protecting Kidney Function During Heart Failure

... a peptide that helps preserve and improve kidney function during heart failure, without affecting blood ... is that this compound will help protect kidney function while you're being treated, and possibly shorten ... and fluid retention. All can occur when heart function is impaired. Seven Years of Research ...

Quark Pharmaceuticals Announces the Presentation of Data Indicating Potential Utility of QPI-1002 in Chronic Kidney Disease at the RNA Interference Summit

... (AKI) and one Phase I/II study for delayed graft function (DGF) in kidney transplantation. QPI-1002 ... cardiovascular surgery, and for delayed graft function (DGF) following kidney transplantation. CKD is a ... disease, which inevitably leads to loss of kidney function and development end stage renal disease that ...

Sangamo BioSciences Presents Positive Phase 2 ZFP Therapeutic Data at ADA 2009

... effective in protecting motor and sural nerve function from disease-induced nerve damage. Sangamo has ... in several measurements of nerve health and function in subjects with diabetic neuropathy. For more ... gradually evolve to loss of sensation and motor function as nerve damage progresses. Ulcers and sores may ...

DaVita's Kidney Calculator iPhone App Downloaded in 24 Countries

... calculates Glomerular filtration rate (GFR) as a function of a patient's age, serum creatinine level, ... professionals to be the best measure of kidney function and is used to plan life-saving treatment. ... Additionally, the application includes a search function to find nephrologists, information on educational ...

Women Who Run May Benefit From Extra Folic Acid

... folic acid supplementation improved vascular function in young female runners who stopped menstruating ... healthy, but six of them had reduced vascular function and irregular or absent menstrual periods. The researchers measured the women's vascular function before and after four to six weeks of treatment ...

NYP/Weill Cornell physician-scientists present at 2009 American Transplant Congress in Boston

... pediatric kidney could not provide adequate renal function for an adult. This practice has the potential to ... donors due to concerns over inferior kidney function in the recipient. The authors have shown that ... donors younger than 50. It was noted that kidney function was lower, though acceptable, in recipients of ...

Point-of-Sale Printers May Trigger Asthma

... the lottery company. Very quickly, her airway function decreased by 19 percent, the researchers ... Again, a decrease in the same measure of airflow function occurred, this time a drop of 15 percent. Her respiratory function eventually returned to normal. The woman has ...

A first choice of renal function tests in hepatectomy patients

... by a simple method as a preoperative renal function test, Ccr is not strictly equal to glomerular ... the reliability of eGFR as a preoperative renal function test. A research article to be published on ... recommended as a first-choice preoperative renal function test in patients undergoing hepatectomy. ...

Study Shows NeuroStar TMS Therapy(R) Improved Key Elements of Cognition in Patients with Major Depressive Disorder

... improvements on both overall cognitive function and short-term verbal memory. These positive ... added. About the Study Cognitive function was examined in a multi-site, randomized ... at six weeks). This improvement in cognitive function was not seen in placebo-treated patients. ...

UCSF creates fast, affordable tool for finding gene 'on-off' switches

... genes off, researchers can study specific genetic function and start to identify drugs or therapeutics to ... on untargeted genes. Research into gene function has been done for years with worms and fruit ... McManus said. But in mammals, studying the function of individual genes can often cost a laboratory ...

More evidence for the benefit of exercise in cardiovascular disease -- and even in heart failure

... four times daily for four weeks can improve the function of (endothelial) cells lining the circulatory ... of maximal aerobic capacity. Endothelial function was assessed by ultrasound measurement of ... study on the effect of exercise on endothelial function will be presented along with the other two ...

Science Zeroes In on New Alzheimer's Drug Target

... HDAC inhibitor-type drug could improve cognitive function in a mouse model of Alzheimer's disease. "To ... is better, then something that opposes HDAC2 function would be expected to improve memory or cognition ... of once-promising proteins that failed to function in humans as they did in animals. "There are ...

Max Muscle Sports Nutrition Offers Support for Hydroxycut Recall

... local Max Muscle store to support healthy liver function and its operating efficiency. Max Muscle Sports ... and nutrients to nourish the liver for optimal function and health." The liver is the largest ... gallbladder and intestines are working at optimal function which is essential for peak athletic performance ...

JCI online early table of contents: May 1, 2009

... determined that Fog2 regulates adult mouse heart function and the growth of new coronary vessels. The ... birth. However, these mice had decreased heart function and insufficient coronary vessels, which led to a ... for maintaining heart and coronary vessel function in the adult mouse heart. TITLE: Fog2 is ...

Tips from the American Journal of Pathology

... prostate cancer and exerts growth-inhibitory function through down-regulation of cyclins and ... in mice, Tong et al conclude that "TIP30 may function as a tumor suppressor gene and play important ... treated cells with a molecule that disrupts the function of lysosomes, cell components responsible for ...

Secondhand Smoke Quickly Affects Blood Vessels

... April 17 (HealthDay News) -- Cardiovascular function can be affected by as little as 10 minutes ... the smoke, their respiratory and cardiovascular function was measured by the researchers. The results ... that has shown that smoke harms cardiovascular function and extended those findings by showing that this ...

AAI honors Chen Dong for breakthrough T lymphocyte research

... diseases, but its origins were unknown and function poorly understood. By revealing the Th17 pathway, ... transcriptional regulation of Th17 development, function of Th17 cytokines, environmental regulation of Th17 function and the cell's significant plasticity. Dong ...

New Research Suggests Drinking as Little as One Cup of Black Tea Per Day May Help Maintain Cardiovascular Function and Heart Health

... "In our study, black tea affected vascular function in normal individuals. We observed that vascular function improvement exerted by black tea started with one ... tea may help maintain healthy cardiovascular function in common tea drinkers. Further studies are ...

VA/UAB study looks at functional decline in older patients after hospitalization

... for surgery returned to normal baseline function more quickly and more completely than did ... condition to be fixed and thus to be able to function as well as or better than before. Our analysis ... there is no real expectation of full recovery of function by the patient, family or health care providers. ...

Siemens Highlights Cardiology Excellence from Prevention to Follow-up at ACC 2009

... first fully automatic software module for cardiac function analysis with MRI. This powerful module is used ... enables the visualization and analysis of heart function disorders through the dynamic volume display of ... heart. With this flexible tool, the cardiac function can be calculated from almost any combination of ...

URI scientists reveal mechanism that regulates cancer-causing gene

... division, and death. In normal cells, the function of Src is turned off, and it is turned on only ... cell. Thus, it is crucial to understand how Src function is controlled. Reactive oxygen species have ... indicates that ROS can directly regulate the function of Src function, and thus indirectly control many ...

Genes May Boost Harm to Kids From Secondhand Smoke

... researchers. "Many factors can affect lung function and growth, including genetic variation and ... have measurable and predictable effects on lung function growth and susceptibility to environmental ... colleagues analyzed eight years' worth of lung function and genotyping data from more than 2,100 ....

Innovative Shoulder Surgery Offers Exciting New Option for South Florida Residents with Severe Shoulder Problems

... -- A breakthrough shoulder surgery is restoring function and relieving pain in people who have lost the ... up of four muscles and tendons that control the function of the shoulder and connects the Humerus (upper ... for those patients whose rotator cuffs no longer function and cannot be repaired," said Dr. Meadows, a ...
Other Contentschloroplastschloroplastschordateschordatejumpingjumpingjumpingjumpingwalkwalkwalkwalkwalkwalkwalkwalkchyme
(Date:11/26/2009)..., Heidelberg, 27 November 2009 What are the ba...ts required to produce a cell that can survive on ...a cell, and understand how an entire organism func...tions that scientists in a partnership between the...eidelberg, Germany, and the Centre de Regulacio Ge...
(Date:11/25/2009)... Athens, Ga. Bacteria don,t have easy lives. In a...he bugs, they have natural enemies called bacterio...th every two days. , Still, bacteria and anothe...scovered in extreme environments such as deep-sea ...rt because they have a built-in defense system tha...
(Date:11/25/2009)... Over the course of a lifetime, the heart pumps so...n the order to do this, the muscle fibers of the h...oup headed by Dr. Wolfgang Rottbauer, vice chair o...versity Hospital (Chairman: Prof. Dr. H. A. Katus)... the stability of the smallest muscular unit, the ...
Breaking Biology News(10 mins):First-ever blueprint of a minimal cell is more complex than expected 2First-ever blueprint of a minimal cell is more complex than expected 3Researchers discover biological basis of 'bacterial immune system' 2Researchers discover biological basis of 'bacterial immune system' 3New genetic cause of cardiac failure discovered 2BioCryst Awarded Additional 2477 2 Million by the U S Department of Health 26 Human Services To Develop Peramivir for Influenza 57736 1BioCryst Awarded Additional 2477 2 Million by the U S Department of Health 26 Human Services To Develop Peramivir for Influenza 57736 2BioCryst Awarded Additional 2477 2 Million by the U S Department of Health 26 Human Services To Develop Peramivir for Influenza 57736 3BioCryst Awarded Additional 2477 2 Million by the U S Department of Health 26 Human Services To Develop Peramivir for Influenza 57736 4BioCryst Awarded Additional 2477 2 Million by the U S Department of Health 26 Human Services To Develop Peramivir for Influenza 57736 5King Announces Commercial Availability of EMBEDA 28TM 29 57735 1King Announces Commercial Availability of EMBEDA 28TM 29 57735 2King Announces Commercial Availability of EMBEDA 28TM 29 57735 3King Announces Commercial Availability of EMBEDA 28TM 29 57735 4King Announces Commercial Availability of EMBEDA 28TM 29 57735 5King Announces Commercial Availability of EMBEDA 28TM 29 57735 6King Announces Commercial Availability of EMBEDA 28TM 29 57735 7King Announces Commercial Availability of EMBEDA 28TM 29 57735 8King Announces Commercial Availability of EMBEDA 28TM 29 57735 9King Announces Commercial Availability of EMBEDA 28TM 29 57735 10King Announces Commercial Availability of EMBEDA 28TM 29 57735 11Simbionix USA Corporations Innovative Development Division Releases Two New Breakthrough Technologies 14167 1Simbionix USA Corporations Innovative Development Division Releases Two New Breakthrough Technologies 14167 2
(Date:11/29/2009)...ment equals a $41,000 pay raise, researchers say ,... Psychological therapy may be much more effective ...ning a lottery prize, suggests an English study. ,...le who provided information about their mental wel...rom a $1,329 course of therapy was so significant ...
(Date:11/29/2009)...ealthcare,s uncertain future and rising costs open...Affordable Acupuncture Scottsdale answers the call...2009 -- Affordable Acupuncture, LLC opened in Scot...t with enthusiasm and gratitude. Its increasing po...o things, need and cost. "As far as I’...
(Date:11/28/2009)...nsider change after 30-minute psychosocial interve...HealthDay News) -- A program that gets persistent ...ir dangerous behavior may lead to significant and ... The new study included 184 men and women with two...ere randomly assigned to one of two interventions....
(Date:11/27/2009)...RNewswire-FirstCall/ -- GSI Group Inc. (Pink Sheet...technology products and semiconductor systems, tod...,s shareholders has been scheduled for Friday, Apr... will be announced in due course. As previously a...e from Stephen Bershad, a holder of greater than t...
(Date:11/27/2009)...-USNewswire/ -- Considered a highly risky and cont...id organ transplantation is now a life-saving main...nd women who gathered at the Winspear Opera House ...edical centers around the world to celebrate the 2...itute (BRTI), one of the pioneers of solid organ t...
Breaking Medicine News(10 mins):Health News:Psychotherapy Can Boost Happiness More Than Money: Study 2Health News:Affordable Acupuncture Greeted with Open Arms by Scottsdale and Phoenix Communities 2Health News:Drunk Drivers May Respond to Brief Motivational Interview 2Health News:GSI Group Calls Shareholders Meeting 2Health News:Organ Transplant Pioneers Celebrate Baylor Regional Transplant Institute's 25th Anniversary 2Health News:Organ Transplant Pioneers Celebrate Baylor Regional Transplant Institute's 25th Anniversary 3
Other TagsAdapterAdrenalAerobicAerobicOther Tagsteacher 2teacher 3dried 2dried 3fruits 2prolong 2