Follicle in Medical News
Navigation Links
Follicle in Medical News
New technique could sustain cancer patients' fertility
... made the new advance by suspending the human follicle in a three-dimensional matrix of a gel-like material. They then flushed the follicle with the same hormones and growth factors that the follicle would be exposed to inside a woman's body. ...New technique could save cancer patients' fertility
... "By being able to take an immature ovarian follicle and grow it to produce a good quality egg, we're ... because the early stage of the human ovarian follicle is really hard to grow in vitro. They're very ... the new advance by suspending the human ovarian follicle in two different kinds of three-dimensional gels. ...... A new home-based hair follicle drug test kit called HairConfirm™ can ... CA (Vocus) June 10, 2009 -- A new home-based hair follicle drug test kit called HairConfirm™ can ... drugs such as cocaine, crack or ecstasy. Hair follicle drug testing is a highly trusted method of drug ...
Researchers identify key proteins needed for ovulation
... of cells, known as the ovarian follicle. The follicle is made largely of cells known as granulosa ... surge of luteinizing hormone, which causes the follicle to rupture, releasing the egg cell. The granulosa cells in the ruptured follicle transform into luteal cells. Previously, ...Schering-Plough Announces European Submission of Fertility Medicine Corifollitropin Alfa
... Corifollitropin alfa, a sustained follicle stimulant, extends options for patients and ... alfa, the company's experimental, sustained follicle stimulant (SFS). This application will follow ... Corifollitropin alfa is designed as a sustained follicle stimulant with the same pharmacodynamic profile ...Getting to the roots of hair loss
... receptor structures on the surface of hair follicle cells from being correctly formed. It has been ... interior which is apparently needed for the hair follicle to function normally. Such a receptor that plays ... an endogenous messenger that binds in the hair follicle to the receptor. This opens up opportunities for ...... on day five . The researchers compared the two BMI groups' average antral follicle count (a predictor of the total number of eggs remaining in a woman's ... follicles, on an ultrasound." "In my opinion, the antral follicle count is the best tool we have for estimating the number of eggs left in a ...
UCSF Researchers Use New Tools to Move in on Cancer Susceptibility Genes
... for the development of hair follicles. In the context of skin cancer, hair follicle development may be important because the hair follicle is a continuously regenerating organ system. Scientists have used this ...Mouse Study Finds Molecule That Tells Hair to Grow
... of complex molecular signals tell hair follicles to go through a cycle of follicle growing, hair growing, follicle receding and hair receding, Crystal explained. The same group of ...... noted that chemical peels containing salicylic acid penetrate into the follicle where acne starts and unclogs the follicle -- leading to an improvement in acne. Dr. Callender cautioned that these ...
Study Spots Gene That Plays Role in Infertility
... these dormant follicles, however, slowly move over to the growing active follicle pool, where they are available for immediate release and, perhaps, ... The length of a woman's reproductive life is determined by the size of her follicle pool and the rate at which this pool is depleted. Until now, scientists ...OHSU is part of national effort to preserve, restore fertility in women with cancer
... follicles in the ovaries and either to preserve or restart this function. follicle growth is necessary for the development of oocytes (fertile eggs) in the ... tissue and, following thawing, to grow follicles in culture or to promote follicle growth after transplantation back into the monkey. In 2004 Lee and ...Hormonal Therapies Offer Effective Solutions for Many Adult Women With Acne
... that contribute to the formation of acne include excess oil gland production, skin inflammation, abnormal maturation of skin cells lining the hair follicle and an increased number of the acne-causing bacteria Propionibacterium acnes . However, hormones also influence both oil gland production and the ...Avidas(TM) Pharmaceuticals and LaRon(TM) Pharma Inc. Announce Co-Promotion Agreement
... Acne vulgaris (commonly called acne) is a skin disease caused by changes in the pilosebaceous units (skin structures consisting of a hair follicle and its associated sebaceous gland). Severe acne is inflammatory, but acne can also manifest in non-inflammatory forms. Acne lesions are commonly ...... thinned, minimizing competing chromophores by blanching vessels and spreading skin pigmentation over a larger area, in addition to pulling the hair follicle closer to the skin's surface. The cumulative result is that energy is delivered more efficiently to achieve excellent clinical results with speed and ...
... treatment. Confirm BioSciences has successfully developed and manufactured numerous screening tests including HairConfirm, the first at home hair follicle drug test in the market, and SteroidConfirm the first steroid test kit on the market. In addition, Confirm BioSciences distributes products in ...
... treatment. Confirm BioSciences has successfully developed and manufactured numerous screening tests including HairConfirm, the first at home hair follicle drug test in the market, and SteroidConfirm the first steroid test kit on the market. In addition, Confirm BioSciences distributes products in ...
... treatment. Confirm BioSciences has successfully developed and manufactured numerous screening tests including HairConfirm, the first at home hair follicle drug test in the market, and SteroidConfirm the first steroid test kit on the market. In addition, Confirm BioSciences distributes products in ...
Cancer survivors at greater risk of birth complications; special monitoring needed
... radiotherapy on reproductive function, radiotherapy to the head can also cause problems by causing the hypothalamus to reduce the production of follicle stimulating hormone and luteinizing hormone, both important in promoting ovulation. "We believe that it is particularly important for all female ...Summertime Sun Exposure Can 'Burn' Acne Sufferers in More Ways than One
... Acne Acne vulgaris (commonly called acne) is a skin disease caused by changes in the pilosebaceous units (skin structures consisting of a hair follicle and its associated sebaceous gland). Severe acne is inflammatory, but acne can also manifest in non-inflammatory forms. Acne lesions are commonly ...... thinned, minimizing competing chromophores by blanching vessels and spreading skin pigmentation over a larger area, in addition to pulling the hair follicle closer to the skin's surface. The cumulative result is that energy is delivered more efficiently to achieve excellent clinical results with speed and ...
NovaBay Pharmaceuticals, Inc. Reports First Quarter 2009 Financial Results
... based on an established pre-clinical model. Importantly, these data combined with the past preclinical work that showed NVC-422 kills P. acne in the follicle which strongly suggests that NVC-422 may be a potent and well-tolerated treatment for acne and numerous other serious skin infections. ...... easily identify their potential for becoming pregnant. The First Response(R) Fertility Test for Women is unique in that it allows women to measure follicle stimulating hormone (FSH) levels to evaluate ovarian reserve - egg quantity and quality. Low ovarian reserve is one of the leading factors of ...
The First Oral Based Lead Test, LeadConfirm Professional, Makes Getting The Lead Out Easier
... treatment. Confirm BioSciences has successfully developed and manufactured numerous screening tests including HairConfirm, the first at home hair follicle drug test in the market, and SteroidConfirm the first steroid test kit on the market. In addition, Confirm BioSciences distributes products in ...Hormone Might Help Restore Female Fertility
... researchers injected the participants with either kisspeptin or saline and then measured levels of two sex hormones -- luteinising hormone (LH) and follicle stimulating hormone (FSH) -- essential for ovulation and fertility. The women who received kisspeptin had a 48-fold increase in LH and a 16-fold ...Lumenis(R) Introduces LightSheer(R) Duet(TM) for High Speed Permanent Hair Reduction
... thinned, minimizing competing chromophores by blanching vessels and spreading skin pigmentation over a larger area, in addition to pulling the hair follicle closer to the skin's surface. The cumulative result is that energy is delivered more efficiently to achieve excellent clinical results with speed and ...Seattle's First Bald Girls Do Lunch(R)
... for online payment information. Alopecia areata is considered to be autoimmune, meaning that the body shuts down its own hair follicle function. With few acceptable treatments for advanced cases Chassin favors pro-active strategies for feeling whole today over hoping for a cure. Her ...Beauty and grooming science evolves
... the five-blade razor improves the closeness of the shave through the "hysteresis effect," which results from a slight hair extension out of the follicle as the first blade engages and from the hair being cut further down the hair shaft by the subsequent blades. But the five-blade razor goes far beyond ...Make Lashes Longer, Thicker, and Darker with Latisse™
... of Latisse™ is discontinued, eyelashes will gradually return to their pre-treatment state over a period of weeks to months (the average eyelash follicle cycle). "Clinical studies have shown that Latisse™ works well. Virtually everyone who has used it has seen great results. Until now ...New Hair Loss Treatment with BOTOX
... it is a condition by which hair follicles under the scalp shrink to the point where they no longer generate replacement follicles. Since each follicle typically regenerates every 2-6 years, baldness is a slow but continual physiological process that results in patches of baldness on the scalp ...... is a genetic condition where hair follicles are susceptible to a by product of testosterone called dihydrotestosterone, or DHT, which causes the hair follicle to shed the hair and affects both men and women alike. The 5-alpha-reductase enzyme converts testosterone to DHT and is found in the hair follicles ...
Fertility experts present the latest research at reproductive medicine meeting
... evaluate the effect of chemotherapy on ovarian function in young women with breast cancer, assessing a marker of ovarian reserve, MIS, as well as E2, follicle Stimulating Hormone (FSH) and menstrual status. Chemotherapy decreases ovarian reserve rapidly and dramatically as reflected by levels of MIS. After ...Changes in sex steroids associated with menopause
... Westchester, Ill. A study in the Oct. 1 issue of the journal Sleep shows that the increased rate of follicle stimulating hormone (FSH) change that occurs during menopause is associated with increased objective sleep duration but poor subjective sleep ....New ovarian stimulation technique offers more cancer patients the chance to preserve their fertility
... time from the start of menstruation to ovulation) using standard stimulation medications (GnRH-analogues and human menopausal gonadtropin, HMG, or follicle stimulation hormone, FSH). In a second group of 12 women they started stimulation during the luteal phase, using GnRH-antagonists and recombinant FSH ...Sleep problems associated with menopause vary among ethnic groups
... in estradiol, the major form of estrogen in the body, were associated with trouble falling asleep and waking several times, and increases in follicle stimulating hormone (FSH), a reproductive hormone, associated with waking several times. In naturally postmenopausal women, women who were on ...New photo 'op' for ovaries may solve some mysteries of infertility
... to solve the problems." The inner daily workings of the ovary largely remain a mystery waiting to be solved. "We don't understand how each follicle is selected to begin the process of ovulation," Woodruff said. "What caused this one to be selected when it's May and you're 19 years old while there ...Zebrafish enable scientists to study the migration of neurons that enable sexual maturity
... in the brain begins releasing more gonadotropin releasing hormone, or GnRH, Dr. Layman explains. GnRH stimulates the pituitary gland to make follicle stimulating hormone and luteinizing hormone, which prompt ovaries to produce estrogen and eggs and testes to produce testosterone and sperm. But ...Women's biological clock revealed: Hormone may predict age at menopause
... accurately than chronological age alone. The levels of AMH in the blood reflect the number of small follicles present in a womans ovaries. This follicle stock enables reproduction by ensuring monthly ovulations. Depletion of the stock leads to menopause, which normally occurs between 40 and 60 years ...Jan Marini Skin Research Introduces Age Intervention(R) Transitions - a New Frontier in Skin Care
... and discoloration. Age Intervention Transitions' unique formula resolves or minimizes acne breakouts while dramatically improving the appearance of follicle size, fine lines, rough facial texture and that nasty leftover acne discoloration. Transitions combines acne clearing and prevention with ...Protein that controls hair growth also keeps stem cells slumbering
... we have been able to activate the hair cycle without accompanying signs of tumorigenesis," says Fuchs. "If we can control the activation process of follicle stem cells without promoting tumorigenesis, then this would be a big move in the right direction." ...Other ContentsridgeridgemicrocephalymidwifemidwifeheadachesheadachesheadachesheadachesheadachesOther TagsArterieMalaysWarneNevNevNevOther Tagsavoidance 2avoidance 3torn 2suspected 2suspected 3suspected 4suspected 5suspected 6suspected 7suspected 8huge 2huge 3huge 4huge 5huge 6huge 7huge 8huge 9huge 10conventional 2conventional 3conventional 4conventional 5conventional 6conventional 7conventional 8conventional 9conventional 10suicide 2region 2region 3region 4region 5region 6region 7region 8region 9region 10
(Date:11/30/2009)...ratures continue to rise scientists are presented ...ecies respond and adapt. In a paper published in ...odriguez-Trelles and Dr Miguel Rodriguez assess th... of approximately 0.6˚C has already affected ...ng ecologists and evolutionary biologists is to pr...
(Date:11/30/2009)...report published in the December 2009 print issue ...lar type of control over their fertility that wome...sts have found how and where androgenic hormones w...on and male fertility. This opens a promising aven...discovery also offers hope to those who cannot hav...
(Date:11/26/2009)...r impressive antlers, red deer have been caught in... antlers are much more than decorative. They are l...ing. John Currey, from The University of York, UK,...f bone for over half a century and has become fasc...ugh a long-standing collaboration with Tomas Lande...
Breaking Biology News(10 mins):How can scientists measure evolutionary responses to climate change? 2Tough yet stiff deer antler is materials scientist's dream 2Deerfield Spa The Poconos Most Affordable Destination Spa Schedules Ribbon Cutting Event for Grand Opening of New Day Spa 51478 1Deerfield Spa The Poconos Most Affordable Destination Spa Schedules Ribbon Cutting Event for Grand Opening of New Day Spa 51478 2Hologic to Present at the 29th Annual Canaccord Adams Global Growth Conference 51475 1Hush little baby Linking genes brain and behavior in children 9237 1Hush little baby Linking genes brain and behavior in children 9237 2(Date:11/30/2009)...30 At a briefing of the...and the Consortium for Citizens with Disabilities ...ic Policy and Advocacy for NCOA, called on Congres...sponds to the growing crisis in long-term care for...ns of seniors, after working hard all their lives,...
(Date:11/30/2009)...mic is far from over. Every year, almost three mi...lion die from AIDS-related diseases." ,, WASHI... AIDS Day 2009 the Global AIDS Alliance (GAA) call...n two recent alarming reports from the World Healt...c continues to be of catastrophic proportion, affe...
(Date:11/30/2009)...g significant impact, CBO analysis understates the...ewswire/ -- The Blue Cross and Blue Shield Assoc...rding the estimate released today by the Congressi...irmed what many economists, actuaries, and health ...lthcare reform bill would make coverage more expen...
(Date:11/30/2009)...s equivalent to 113 chest X-rays, study finds , ... than half of patients who have abdominal/pelvic C...ts that expose them to extra radiation, U.S. resea...d pelvic series were performed on 500 patients age...30 to 50 years of age. The researchers concluded t...
(Date:11/30/2009)... 30 SEIU Local 21LA mem...ration Sodexo will hold a rally Tuesday, Dec. 1, 2...headquarters, 3800 Desire Parkway, New Orleans, to...y disciplinary policies that target employees who ...er. Sodexo employees who clean schools in the Reco...
Breaking Medicine News(10 mins):Health News:NCOA, Bedlin Brief Leading Aging Organizations on Health Care Reform, Needed Long-Term Care Provisions 2Health News:GAA Calls on President Obama to Act on the Reality of AIDS 2Health News:GAA Calls on President Obama to Act on the Reality of AIDS 3Health News:CBO Confirms That Premiums Will Increase Under the Senate Healthcare Reform Bill 2Health News:CT Scan Patients May Get Unnecessary Imaging 2Health News:As H1NI Hits New Orleans in Force: School Custodians to Hold Rally to Call on Contractor to Stop Penalizing Workers Coping With Illness 2[0] NCOA, Bedlin Brief Leading Aging Organizations on Health Care Reform, Needed Long-Term Care Provisions[0] GAA Calls on President Obama to Act on the Reality of AIDS[0] CBO Confirms That Premiums Will Increase Under the Senate Healthcare Reform Bill[0] CT Scan Patients May Get Unnecessary Imaging[1] As H1NI Hits New Orleans in Force: School Custodians to Hold Rally to Call on Contractor to Stop Penalizing Workers Coping With Illness
| Copyright © 2003-2009 Bio-Medicine. All rights reserved. ABOUT | CONTACT US | DISCLAIMER | PRIVACY POLICY | TERMS AND CONDITIONS |  |