Cardiovascular in Medical Dictionary
Navigation Links
Cardiovascular in Medical Dictionary
... defect Being older than 30 Being female Low cardiovascular fitness High percentage of body fat Use of ... that hasn't been repaired. CV Peri-Guard cardiovascular patch cardiovascular patch designed for numerous ...
... cardiovascular disease quiz: Risk and prevention Although some people are born with cardiovascular disease , more often it develops later in life ... habits. The consequences can be devastating. cardiovascular Disease s Definitions and Terms ...
... cardiovascular disease quiz: Risk and prevention Although some people are born with cardiovascular disease , more often it develops later in life as ... habits. The consequences can be devastating. cardiovascular Disease s Definitions and Terms ...
... States, accounting for more than half of all cardiovascular events in men and women under the age of 75. ... CAD ( coronary artery disease ) See Cardiology / cardiovascular Operative Reports. Patients who have ... between the ages of 45 and 64 has some form of cardiovascular disease , ranging from coronary artery disease ...
... prognostic test to assess the risk of cardiovascular or peripheral vascular disease . Early ... , C-reactive protein (CRP), are tied to cardiovascular risk. Blood tests such as a complete blood ... of Breath C-Reactive Protein Signals cardiovascular Risk ... ...
... eating that will help to keep your heart and cardiovascular system functioning well. Heart -healthy eating ... defect Being older than 30 Being female Low cardiovascular fitness High percentage of body fat Use of ... phase of the disease . The circulatory or cardiovascular system is composed of the heart , arteries, ...
... Vascular Diseases cardiovascular Disease s Definitions and Terms ... as a free, browsable resource for all. cardiovascular disease s include arteriosclerosis , coronary ... s of the aorta and its branches, ... cardiovascular disease s are higher among persons with high ...
... s flexibility exercise s Your aerobic training zone ... Aerobic ( cardiovascular ) exercise Particularly important to prevent coronary heart disease is aerobic or cardiovascular exercise . This is any kind of activity that increases your breathing ...
... and ventricular septal defect Being older than 30 Being female Low cardiovascular fitness High percentage of body fat Use of alcohol or tobacco ... ... In particular, the effects of caffeine on fibrocystic breast disease , cardiovascular disease , birth defects , reproductive function, and behavior in ...
... iness when others are warm. CAUSES"Poor circulation can be caused by cardiovascular disease , low thyroid, and vitamin E deficiency . Poor circulation ... walking is an excellent way to increase circulation , improve cardiovascular health and maintain bone strength. Its benefits include improved ...
... Cocaine is a powerful central nervous system stimulant with potent cardiovascular ( heart and blood vessel) side effects. Cocaine : The most potent ... Cocaine use can cause a number of medical problems -- including cardiovascular ( heart and blood vessels) collapse, irregular heart beats, heart ...
... prevention of coronary heart disease in patients without symptomatic cardiovascular disease who have average to moderately elevated total and LDL ... weight alone (without other risk factors) can increase your risk for cardiovascular disease . According to the American Heart Association, eliminating ...
... heart is called the aortic root. Micro circulation Vaso dilation cardiovascular system The circulatory or cardiovascular system is composed of the heart , arteries, capillaries, venules and ...
... . Gumma ta, which are large sores inside the body or on the skin . cardiovascular syphilis , which affects the heart and blood vessels. ... and can cause a wide variety of neurologic deficit s. neurosyphilis cardiovascular complications (aortitis and aneurysm s) destructive lesion s of the ...
... Disease One in 9 women between the ages of 45 and 64 has some form of cardiovascular disease , ranging from coronary artery disease to stroke or renal ... reduce your risk for heart disease (see the section titled 'Eating for cardiovascular Health'). Ongoing medical problems like heart disease , asthma , ...
... blood pressure is a risk factor for heart disease , stroke and other cardiovascular conditions. Fortunately, it can be controlled. Tune in to find out how. ... years. The most common causes of heart failure are the chronic cardiovascular disease s hypertension ( high blood pressure ) and coronary artery ...
... PDA (Patent Ductus Arteriosus) ... Effect of pravastatin on cardiovascular events in older patients with myocardial infarct ion and cholesterol ... reduce the risk of stroke , myocardial infarct ion , and death from cardiovascular causes in patients 55 and over either with a history of coronary artery ...
... PDA (Patent Ductus Arteriosus) ... Effect of pravastatin on cardiovascular events in older patients with myocardial infarction and cholesterol ... reduce the risk of stroke , myocardial infarction , and death from cardiovascular causes in patients 55 and over either with a history of coronary artery ...
... smoking causes wrinkles ? Melinda/ Pennsylvania ... Smoking and cardiovascular disease : Smoking , in addition to high cholesterol , high blood ... obesity , and diabetes tops the list as a primary risk factor for cardiovascular disease , ... Smoking increases a person's risk for high cholesterol ...
... Stroke Brain tumor Parkinson 's disease Multiple sclerosis cardiovascular disease 101: Know your heart and blood vessels cardiovascular disease quiz: Risk and prevention ... FAINTING ( BENIGN ) - A form ...
... Last updated July 14, 1999 ... Micro circulation Vasodilation cardiovascular system The circulatory or cardiovascular system is composed of the heart , arteries, capillaries, venules and ...
... 1999, 282:468-474. Research activities are focused on the prevention of HIV infection , violence , substance abuse , teen pregnancy , cardiovascular disease , and cancer . Service activities range from a rodent control project to a community computer access initiative. Many people with panic ...
... genetic factors trauma to the blood vessel, such as surgery or a gunshot wound ... " Aneurysm s and Other Vascular Disorders." In cardiovascular Disease s and Disorders Sourcebook, ed. Karen Bellenir and Peter D. Dresser. Detroit: Omnigraphics, Inc., 1995. Dzau, Victor J., and Mark A.Creager. ...
... with blood vessels that affect blood flow. Angiography is one of the most useful and accurate tools in diagnosing and evaluating certain cardiovascular problems. Who is angiography for? Your doctor may recommend that you undergo coronary angiography if: ... Cardiac angiography ; ...
... disease surgery Looking after your heart ... The need for bypass surgery or angioplasty was reduced by 37%, and death s from all cardiovascular causes were reduced by 32%. ...
... or aortic stenosis — is a condition in which the heart 's aortic valve narrows. " Aortic Stenosis ." In Heart Disease : A Textbook of cardiovascular Medicine. Philadelphia: W. B. Saunders Co., 1997. McGoon, Michael D. " Aortic Stenosis ." In Mayo Clinic Heart Book. New York: William Morrow and ...
... legs are most often affected. Atherosclerosis Disease of blood vessels caused by deposits of cholesterol on the inside walls of the vessels. cardiovascular disease Disease that affects the heart and blood vessels. Hardening of the arteries ( atherosclerosis ). Exactly how atherosclerosis leads ...
... and digestion . Autonomic neuropathy : Disease of the nerve s affecting mostly the internal organ s such as the bladder muscle s, the cardiovascular system, the digestive tract, and the genital organ s. Treatment for autonomic neuropathy depends on the underlying cause and the ...
... auto immune origin. Blood Disorders and Lymphatic System Bones, Joints , and Muscle s Brain and Nervous System Cancer s and Tumor s cardiovascular (Circulatory System) Digestive System Disabilities Ears and Hearing Disorders Eating Disorders Endocrine Disorders ... Less common ...
... identify normal blood pressure as lower than 120/80 - many experts think 115/75 is optimal. Higher readings indicate increasingly serious risks of cardiovascular disease . Blood pressure measures the force of blood against the walls of your blood vessels. Blood pressure that remains high over time ...
... healthy habits that build and maintain strong ... ... Swimming, cycling and machines such as elliptical trainers can provide a good cardiovascular workout, but because they're low impact, they're not as helpful for improving bone health as weight-bearing exercise s are. Add soy to your ...
... shape, and body hair . selective estrogen receptor modulator (SERM) New class of drug with selective ability to affect the skeletal and cardiovascular systems similar to estrogen , but without having the unwanted effects estrogen commonly has on the breasts and uterus . ...
... detect heart and lung conditions Even with today's high-tech medical devices, the basic chest X-ray remains an important tool in diagnosing cardiovascular disease s. Here's a look at how it works. Chest X-ray s for chronic obstructive pulmonary disease ( COPD ) Credits Email this article Print ...
... detect heart and lung conditions Even with today's high-tech medical devices, the basic chest X -ray remains an important tool in diagnosing cardiovascular disease s. Here's a look at how it works. Chest X -ray s for chronic obstructive pulmonary disease ( COPD ) Credits Email this article Print ...
... during the first trimester. Less than half of these women have a spontaneous abortion . Signs And Tests: ... Thrombus A clot in the cardiovascular system (the system that circulates blood throughout the body). For Your Information Books ... The blockage typically occurs when a blood ...
... diagnosis , treatment and prevention . Complement ary and Alternative Medicine Evaluating Emerging Professions ... Complement ing the cardiovascular Program of Children's Hospital Boston is the nation's most intensive clinical and basic research program focused on pediatric heart disease . ...
... such as 911. Prevention : ... Clearing Up Confusion About Constipation Cooling Painful Hot Spots in Fibromyalgia COX-2 Inhibitors and cardiovascular Risk ... Dizziness or confusion Weakness or paralysis on one side of the body Sudden, severe numbness in any part of the body Visual ...
... In Texas Heart Institute Heart Owner's Handbook. New York: John Wiley & Sons, Inc., 1996. "If Your Child Has A Congenital Heart Defect." In cardiovascular Disease s and Disorders Sourcebook, ed. Karen Bellenir and Peter D. repair of congenital heart disease , transplantation of organ s, and ...
... Fibrosis - Nutrition al Considerations) Cystic Fibrosis - Nutrition al Considerations Diet for Age (Appropriate Diet for Age) Diet for cardiovascular Disease , Known As CVD ( Heart Disease and Diet ) ... ACOG Addresses Latest Controversies in Obstetrics (December 12) Ob-Gyns Offering ...
... cardiovascular disease quiz: Risk and prevention Although some people are born with cardiovascular disease , more often it develops later in life ... habits. The consequences can be devastating. cardiovascular Disease s Definitions and Terms ...
... cardiovascular disease quiz: Risk and prevention Although some people are born with cardiovascular disease , more often it develops later in life as ... habits. The consequences can be devastating. cardiovascular Disease s Definitions and Terms ...
... States, accounting for more than half of all cardiovascular events in men and women under the age of 75. ... CAD ( coronary artery disease ) See Cardiology / cardiovascular Operative Reports. Patients who have ... between the ages of 45 and 64 has some form of cardiovascular disease , ranging from coronary artery disease ...
... prognostic test to assess the risk of cardiovascular or peripheral vascular disease . Early ... , C-reactive protein (CRP), are tied to cardiovascular risk. Blood tests such as a complete blood ... of Breath C-Reactive Protein Signals cardiovascular Risk ... ...
... eating that will help to keep your heart and cardiovascular system functioning well. Heart -healthy eating ... defect Being older than 30 Being female Low cardiovascular fitness High percentage of body fat Use of ... phase of the disease . The circulatory or cardiovascular system is composed of the heart , arteries, ...
... Vascular Diseases cardiovascular Disease s Definitions and Terms ... as a free, browsable resource for all. cardiovascular disease s include arteriosclerosis , coronary ... s of the aorta and its branches, ... cardiovascular disease s are higher among persons with high ...
... s flexibility exercise s Your aerobic training zone ... Aerobic ( cardiovascular ) exercise Particularly important to prevent coronary heart disease is aerobic or cardiovascular exercise . This is any kind of activity that increases your breathing ...
... and ventricular septal defect Being older than 30 Being female Low cardiovascular fitness High percentage of body fat Use of alcohol or tobacco ... ... In particular, the effects of caffeine on fibrocystic breast disease , cardiovascular disease , birth defects , reproductive function, and behavior in ...
... iness when others are warm. CAUSES"Poor circulation can be caused by cardiovascular disease , low thyroid, and vitamin E deficiency . Poor circulation ... walking is an excellent way to increase circulation , improve cardiovascular health and maintain bone strength. Its benefits include improved ...
... Cocaine is a powerful central nervous system stimulant with potent cardiovascular ( heart and blood vessel) side effects. Cocaine : The most potent ... Cocaine use can cause a number of medical problems -- including cardiovascular ( heart and blood vessels) collapse, irregular heart beats, heart ...
Coronary artery bypass surgery
... create a detour around the blocked artery . Insufficient data on the cardiovascular safety of long-term use of Bextra, along with the increased risk of adverse cardiovascular events in short-term coronary artery bypass surgery trials. The PET ...... prevention of coronary heart disease in patients without symptomatic cardiovascular disease who have average to moderately elevated total and LDL ... weight alone (without other risk factors) can increase your risk for cardiovascular disease . According to the American Heart Association, eliminating ...
... heart is called the aortic root. Micro circulation Vaso dilation cardiovascular system The circulatory or cardiovascular system is composed of the heart , arteries, capillaries, venules and ...
... . Gumma ta, which are large sores inside the body or on the skin . cardiovascular syphilis , which affects the heart and blood vessels. ... and can cause a wide variety of neurologic deficit s. neurosyphilis cardiovascular complications (aortitis and aneurysm s) destructive lesion s of the ...
... Disease One in 9 women between the ages of 45 and 64 has some form of cardiovascular disease , ranging from coronary artery disease to stroke or renal ... reduce your risk for heart disease (see the section titled 'Eating for cardiovascular Health'). Ongoing medical problems like heart disease , asthma , ...
... blood pressure is a risk factor for heart disease , stroke and other cardiovascular conditions. Fortunately, it can be controlled. Tune in to find out how. ... years. The most common causes of heart failure are the chronic cardiovascular disease s hypertension ( high blood pressure ) and coronary artery ...
... PDA (Patent Ductus Arteriosus) ... Effect of pravastatin on cardiovascular events in older patients with myocardial infarct ion and cholesterol ... reduce the risk of stroke , myocardial infarct ion , and death from cardiovascular causes in patients 55 and over either with a history of coronary artery ...
... PDA (Patent Ductus Arteriosus) ... Effect of pravastatin on cardiovascular events in older patients with myocardial infarction and cholesterol ... reduce the risk of stroke , myocardial infarction , and death from cardiovascular causes in patients 55 and over either with a history of coronary artery ...
... smoking causes wrinkles ? Melinda/ Pennsylvania ... Smoking and cardiovascular disease : Smoking , in addition to high cholesterol , high blood ... obesity , and diabetes tops the list as a primary risk factor for cardiovascular disease , ... Smoking increases a person's risk for high cholesterol ...
... Stroke Brain tumor Parkinson 's disease Multiple sclerosis cardiovascular disease 101: Know your heart and blood vessels cardiovascular disease quiz: Risk and prevention ... FAINTING ( BENIGN ) - A form ...
... Last updated July 14, 1999 ... Micro circulation Vasodilation cardiovascular system The circulatory or cardiovascular system is composed of the heart , arteries, capillaries, venules and ...
... 1999, 282:468-474. Research activities are focused on the prevention of HIV infection , violence , substance abuse , teen pregnancy , cardiovascular disease , and cancer . Service activities range from a rodent control project to a community computer access initiative. Many people with panic ...
... genetic factors trauma to the blood vessel, such as surgery or a gunshot wound ... " Aneurysm s and Other Vascular Disorders." In cardiovascular Disease s and Disorders Sourcebook, ed. Karen Bellenir and Peter D. Dresser. Detroit: Omnigraphics, Inc., 1995. Dzau, Victor J., and Mark A.Creager. ...
... with blood vessels that affect blood flow. Angiography is one of the most useful and accurate tools in diagnosing and evaluating certain cardiovascular problems. Who is angiography for? Your doctor may recommend that you undergo coronary angiography if: ... Cardiac angiography ; ...
... disease surgery Looking after your heart ... The need for bypass surgery or angioplasty was reduced by 37%, and death s from all cardiovascular causes were reduced by 32%. ...
... or aortic stenosis — is a condition in which the heart 's aortic valve narrows. " Aortic Stenosis ." In Heart Disease : A Textbook of cardiovascular Medicine. Philadelphia: W. B. Saunders Co., 1997. McGoon, Michael D. " Aortic Stenosis ." In Mayo Clinic Heart Book. New York: William Morrow and ...
... legs are most often affected. Atherosclerosis Disease of blood vessels caused by deposits of cholesterol on the inside walls of the vessels. cardiovascular disease Disease that affects the heart and blood vessels. Hardening of the arteries ( atherosclerosis ). Exactly how atherosclerosis leads ...
... and digestion . Autonomic neuropathy : Disease of the nerve s affecting mostly the internal organ s such as the bladder muscle s, the cardiovascular system, the digestive tract, and the genital organ s. Treatment for autonomic neuropathy depends on the underlying cause and the ...
... auto immune origin. Blood Disorders and Lymphatic System Bones, Joints , and Muscle s Brain and Nervous System Cancer s and Tumor s cardiovascular (Circulatory System) Digestive System Disabilities Ears and Hearing Disorders Eating Disorders Endocrine Disorders ... Less common ...
... identify normal blood pressure as lower than 120/80 - many experts think 115/75 is optimal. Higher readings indicate increasingly serious risks of cardiovascular disease . Blood pressure measures the force of blood against the walls of your blood vessels. Blood pressure that remains high over time ...
... healthy habits that build and maintain strong ... ... Swimming, cycling and machines such as elliptical trainers can provide a good cardiovascular workout, but because they're low impact, they're not as helpful for improving bone health as weight-bearing exercise s are. Add soy to your ...
... shape, and body hair . selective estrogen receptor modulator (SERM) New class of drug with selective ability to affect the skeletal and cardiovascular systems similar to estrogen , but without having the unwanted effects estrogen commonly has on the breasts and uterus . ...
... detect heart and lung conditions Even with today's high-tech medical devices, the basic chest X-ray remains an important tool in diagnosing cardiovascular disease s. Here's a look at how it works. Chest X-ray s for chronic obstructive pulmonary disease ( COPD ) Credits Email this article Print ...
... detect heart and lung conditions Even with today's high-tech medical devices, the basic chest X -ray remains an important tool in diagnosing cardiovascular disease s. Here's a look at how it works. Chest X -ray s for chronic obstructive pulmonary disease ( COPD ) Credits Email this article Print ...
... during the first trimester. Less than half of these women have a spontaneous abortion . Signs And Tests: ... Thrombus A clot in the cardiovascular system (the system that circulates blood throughout the body). For Your Information Books ... The blockage typically occurs when a blood ...
... diagnosis , treatment and prevention . Complement ary and Alternative Medicine Evaluating Emerging Professions ... Complement ing the cardiovascular Program of Children's Hospital Boston is the nation's most intensive clinical and basic research program focused on pediatric heart disease . ...
... such as 911. Prevention : ... Clearing Up Confusion About Constipation Cooling Painful Hot Spots in Fibromyalgia COX-2 Inhibitors and cardiovascular Risk ... Dizziness or confusion Weakness or paralysis on one side of the body Sudden, severe numbness in any part of the body Visual ...
... In Texas Heart Institute Heart Owner's Handbook. New York: John Wiley & Sons, Inc., 1996. "If Your Child Has A Congenital Heart Defect." In cardiovascular Disease s and Disorders Sourcebook, ed. Karen Bellenir and Peter D. repair of congenital heart disease , transplantation of organ s, and ...
... Fibrosis - Nutrition al Considerations) Cystic Fibrosis - Nutrition al Considerations Diet for Age (Appropriate Diet for Age) Diet for cardiovascular Disease , Known As CVD ( Heart Disease and Diet ) ... ACOG Addresses Latest Controversies in Obstetrics (December 12) Ob-Gyns Offering ...
Other ContentshomehomehomehomehomehomehomehomehomehomosexualhomosexualmonitormonitormonitormonitormonitormonitormonitormonitormonitorhormonalhormonalhormonalhormonalhormonalhormonalhormonalhookwormhospicehospicehospitalizationhospitalizationhospitalizationhospitalizationOther TagsMultilabelIRMAIRMA
(Date:11/24/2009)... long held secrets of the earth,s history locked i...en very little information on the environments tha...ns of years. Now, a team of researchers from nine ...he tune of $10 million dollars by the National Sci...hings literally. These scientists will drill thro...
(Date:11/24/2009)...2009) New research on bacterial communities throu...edictable temporal patterns, suggesting that scien...onitoring climate change in the polar regions. The... the National Academy of Sciences Early Edition, ... shifted synchronously over time, correlating with...
(Date:11/23/2009)...ts strong evidence that the "synergistic" effect o...ted pollution and indoor endotoxin causes more har...re alone. , Environmental health scientists at...cine have shown that children exposed to both high...dotoxin during early life are six times more likel...
Breaking Biology News(10 mins):LSU gets to the bottom of things -- in Antarctica 2Researchers establish common seasonal pattern among bacterial communities in Arctic rivers 2Exposure to both traffic, indoor pollutants puts some kids at higher risk for asthma later 2Sorrento Therapeutics Inc and QuikByte Software Inc Complete Merger 14153 1Sorrento Therapeutics Inc and QuikByte Software Inc Complete Merger 14153 2Sorrento Therapeutics Inc and QuikByte Software Inc Complete Merger 14153 3Sorrento Therapeutics Inc and QuikByte Software Inc Complete Merger 14153 4NxStage Patient Takes Dialysis Machine on Third Annual Patient Good Will Tour 57690 1NxStage Patient Takes Dialysis Machine on Third Annual Patient Good Will Tour 57690 2NxStage Patient Takes Dialysis Machine on Third Annual Patient Good Will Tour 57690 3Sunesis Pharmaceuticals Receives NASDAQ Notification 14152 1Sunesis Pharmaceuticals Receives NASDAQ Notification 14152 2Sunesis Pharmaceuticals Receives NASDAQ Notification 14152 3(Date:11/25/2009)...ous behavior problems that can occur in children w...ith a treatment plan that includes medication comb...s, according to Yale University researchers and th...9 issue of the Journal of the American Academy of...onducted by the National Institute of Mental Healt...
(Date:11/25/2009)... Nationwide Imaging Services, known...ions for diagnostic imaging equipment, now offerin...ding financing options, service and installation w... Medical Technologies of California) , ...-- Nationwide Imaging Services is proud to announc...
(Date:11/25/2009)...SHINGTON,Nov.25/PRNewswire-FirstCall/--TheAdvisory...lparticipateinthe21stAnnualPiperJaffrayHealthCareC...ecember2,2009at3:00PM(EST),willbetheCompany,sChief...,sChiefFinancialOfficer,MichaelT.Kirshbaum.Thepres...ite,foundat http://www.advisoryboardcompany.com ,t...
(Date:11/25/2009)...LTLAKECITY,Nov.25/PRNewswire/--dazzlesmile,llc www...ptimalhealthscience.com havefileda67-pagefederalla....com,Inc.,JesseWillms,FarendServicesLimited,andAtL...itedStatesDistrictCourtfortheDistrictofUtah,allege...lesmile(TM)brandedteethwhiteningproducts,violation...
(Date:11/25/2009)...CaliforniaMakesLittleProgresstoImproveOverallOutco...ire-USNewswire/-- Today,LungCancerAlliance-Califo...cer .The2009ReportCardisanassessmentofprogressbein...a.LCA-CAisachapterofLungCancerAlliance(LCA),theonl...supportandadvocacyforpeoplelivingwithoratriskforlu...
Breaking Medicine News(10 mins):Health News:Parent training key to improved treatment of behavior problems in children with autism 2Health News:Nationwide Imaging Services, Inc., Leader In Diagnostic Imaging Equipment, Announces Acquisition Of Kosmic Medical, Inc. (dba Atlas Medical Technologies of California) 2Health News:Nationwide Imaging Services, Inc., Leader In Diagnostic Imaging Equipment, Announces Acquisition Of Kosmic Medical, Inc. (dba Atlas Medical Technologies of California) 3Health News:dazzlesmile Sues Epic Advertising and Jesse Willms 2Health News:Lung Cancer Alliance-California Releases 2nd Annual State-Specific Report Card On Lung Cancer 2[0] Parent training key to improved treatment of behavior problems in children with autism[0] Nationwide Imaging Services, Inc., Leader In Diagnostic Imaging Equipment, Announces Acquisition Of Kosmic Medical, Inc. (dba Atlas Medical Technologies of California) [0] The Advisory Board Company to Present at 21st Annual Piper Jaffray Health Care Conference[0] dazzlesmile Sues Epic Advertising and Jesse Willms[0] Lung Cancer Alliance-California Releases 2nd Annual State-Specific Report Card On Lung Cancer
DataMaxmultifilesspectrofluorometerFluoroLogpigmentsmultiwavelengthdisplaysclassifyingbathsgalvanizingpolarisationMultilabelAlphaQuestIRMA
Other Tagsherself 2herself 3herself 4herself 5parliament 2parliament 3elicit 2elicit 3ends 2ends 3ends 4ends 5introduction 2introduction 3introduction 4drops 2mortality 2mortality 3mortality 4mortality 5mortality 6mortality 7
| Copyright © 2003-2009 Bio-Medicine. All rights reserved. ABOUT | CONTACT US | DISCLAIMER | PRIVACY POLICY | TERMS AND CONDITIONS |  |