medicine-news-1/integrated-medical-systems-receives-ce-mark-for-worlds-first-suitcase-intensive-care-unit-55805-3/;msg18067;topicseen

(Date:12/16/2009)... of microfossils found in ocean sediment cores is illuminating ... a critical period of Earth history. , Around 55 ... epoch, the Earth,s poles are believed to have been ... 25 million years later, ice sheets covered Antarctica and ... change from greenhouse to icehouse conditions resulted from decreasing ...

(Date:12/16/2009)... DC US Secretary of Energy Steven Chu announced ... for their outstanding contributions in research and development supporting ... six winners named today will receive a gold medal, ... honored at a ceremony in Washington, DC early next ... the national, economic and energy security of the United ...

(Date:12/16/2009)... get psyched up for contests, but when these rituals ... down before and during events, they could be causing ... for the symptoms of an injury, not the injury ... focuses on musculoskeletal health and sports medicine. "They may ... certain level, but pain occurs for a reason. It ...

(Date:12/17/2009)... Helped, Healed, and Preserved Good Health , ... ... Association (IHRSA) announced today that as part of its Campaign for ... abilities to make 2010 the year we unite in a national ... daily exercise is highly valued and widely practiced. IHRSA is inviting ...

(Date:12/17/2009)... , , THURSDAY, Dec. 17 (HealthDay News) -- Among teenage ... least one of three common sexually transmitted infections -- ... becoming sexually active, a new study has found. , ... also found that it was common for these patients ... within four to six months after treatment of the ...

(Date:12/17/2009)... of Science in Human Resource Development Degree Online , ... ... -- Open enrollment has begun for Villanova’s newly online ... professionals whose busy schedules can’t accommodate a campus-based program. With ... online in March 2010, location is no longer a barrier ...

(Date:12/17/2009)... SAN DIEGO, Dec. 17 Neurocrine Biosciences, Inc. ... entered into a privately negotiated transaction to sell an ... to affiliates of Venrock at a price of $2.09 ... approximately $10 million. Neurocrine expects the financing to close ... closing conditions. ,, A shelf registration statement ...

(Date:12/17/2009)... Procedure Provides Efficient Mechanism to Pursue Approval ... Dec. 17 /PRNewswire-FirstCall/ - Labopharm Inc. (TSX: ... it has initiated the regulatory approval process ... under the Decentralized Procedure (DCP). The DCP ... company to simultaneously pursue regulatory approval for ...

... monoclonal antibody raised against a partial recombinant NFKBIB. ... a.a. ~ 145 a.a) partial recombinant protein with ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...

Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...

... The BD PhosFlow Perm/Wash Buffer I can ... modified signaling proteins to permeabilize cells and ... cell wash buffer. Because saponin-mediated cell permeabilization ... to keep the cells in the presence ...

Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...

Modular Specimen Filing System has five cells that can hold either slides or tissue cassettes....

Shandon Microscope Slide Cabinet with Drawers...

... is the first solid-state,photocoagulator to ... wavelengths. This advanced,laser system makes ... a red or green wavelength,during ... and ensures effective,patient results., For ...

... The PSL utilizes a high luminance white LED ... lightweight, compact design, to give you the freedom ... The PSL Slit Lamp weighs only about 1.5 ... easily and comfortably in your hand. Its ...