medicine-news-1/-2436-billion-charged-for-blood-tests-and-transfusions-for-u-s--premature-infant-market--60663-5/;/a><br

(Date:12/16/2009)... Bacteria inhabited our planet for more than 4 billion ... us by as many eons more. That suggests they ... from Tel Aviv University bacteria expert Prof. Eshel Ben-Jacob ... and Astronomy, grounded in the study of bacteria, presents ... why most people should not automatically opt for the ...

(Date:12/16/2009)... global provider of business process outsourcing (BPO) services, was ... Top 100 IT project of 2009 for its biometric-enabled ... iQor. ,, "We are honored to be recognized among ... and CEO of iQor. "TeQ21 is completely transforming the ... smarter and with the added security biometrics provides. We ...

(Date:12/16/2009)... Calif. and PALM HARBOR, Fla., Dec. 2 ... Bulletin Board: CICI), a leading supplier of ... in the financial industry* and the recognized ... Systems Inc. ("Docubase"), a leading International Electronic ... that they have entered an agreement to ...

(Date:12/17/2009)... Helped, Healed, and Preserved Good Health , ... ... Association (IHRSA) announced today that as part of its Campaign for ... abilities to make 2010 the year we unite in a national ... daily exercise is highly valued and widely practiced. IHRSA is inviting ...

(Date:12/17/2009)... , , THURSDAY, Dec. 17 (HealthDay News) -- Among teenage ... least one of three common sexually transmitted infections -- ... becoming sexually active, a new study has found. , ... also found that it was common for these patients ... within four to six months after treatment of the ...

(Date:12/17/2009)... of Science in Human Resource Development Degree Online , ... ... -- Open enrollment has begun for Villanova’s newly online ... professionals whose busy schedules can’t accommodate a campus-based program. With ... online in March 2010, location is no longer a barrier ...

(Date:12/17/2009)... SAN DIEGO, Dec. 17 Neurocrine Biosciences, Inc. ... entered into a privately negotiated transaction to sell an ... to affiliates of Venrock at a price of $2.09 ... approximately $10 million. Neurocrine expects the financing to close ... closing conditions. ,, A shelf registration statement ...

(Date:12/17/2009)... Procedure Provides Efficient Mechanism to Pursue Approval ... Dec. 17 /PRNewswire-FirstCall/ - Labopharm Inc. (TSX: ... it has initiated the regulatory approval process ... under the Decentralized Procedure (DCP). The DCP ... company to simultaneously pursue regulatory approval for ...

... monoclonal antibody raised against a partial recombinant NFKBIB. ... a.a. ~ 145 a.a) partial recombinant protein with ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...

Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...

... The BD PhosFlow Perm/Wash Buffer I can ... modified signaling proteins to permeabilize cells and ... cell wash buffer. Because saponin-mediated cell permeabilization ... to keep the cells in the presence ...

Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...

Modular Specimen Filing System has five cells that can hold either slides or tissue cassettes....

Shandon Microscope Slide Cabinet with Drawers...

... is the first solid-state,photocoagulator to ... wavelengths. This advanced,laser system makes ... a red or green wavelength,during ... and ensures effective,patient results., For ...

... The PSL utilizes a high luminance white LED ... lightweight, compact design, to give you the freedom ... The PSL Slit Lamp weighs only about 1.5 ... easily and comfortably in your hand. Its ...