Navigation Links
Whatever happened to ...

consumer magazines, including PC Week, PC Magazine, PC/Computing, and InfoWorld, US Magazine and Working Woman. She has written two books on communications and Internet technology, has won numerous awards for journalistic excellence, and was named the #1 newsletter editor by Marketing Computers for two years in a row. To subscribe to DEMOletter please visit: By Chris Shipley 07/18/05

Page: 1 2 3

Related biology technology :

1. Dude, what happened to my job?
2. A funny thing happened on the way out of the back office
Post Your Comments:
TAG: Whatever happened

(Date:11/26/2014)... Bioscience, Inc. (NASDAQ: ROKA ), a molecular diagnostics ... of foodborne pathogens, today announced that Paul G. Thomas ... Annual Healthcare Conference on December 2, 2014 at 4:30pm ET. ... in New York, NY . ... operations, strategies and prospects may be discussed. To listen to ...
(Date:11/24/2014)...   First published articles now ... Elsevier , a world-leading provider of scientific, technical and medical ... of the latest title in the Current Opinion journal ... . Current Opinion in ... to keep up-to-date with the expanding volume of information published ...
(Date:11/24/2014)... November 24, 2014 The new ... from METTLER TOLEDO demonstrates how to reduce the ... analytics and sample panel design can be complicated, ... and protect against corrosion and deposition. Dedicated single ... significant amount of panel space. Additionally, installing and ...
(Date:11/22/2014)... 21, 2014 During his lifetime Richard ... need to surround himself with great people and take ... his friends often marveled at his extraordinarily courageous attitude ... life and -- even with his death impending—that’s how ... disease that would ultimately take his life. , Carrying ...
Breaking Biology Technology:Roka Bioscience to Present at the Piper Jaffray Healthcare Conference 2Elsevier Announces Launch of New Journal: Current Opinion in Food Science 2Elsevier Announces Launch of New Journal: Current Opinion in Food Science 3New Video Shows How to Simplify Cycle Chemistry Sample Panels to Save Time and Costs 2Sherry Sharp, Wife of CarMax Founder, Richard Sharp, Accepts Seat on Board of Cure Alzheimer’s Fund 2Sherry Sharp, Wife of CarMax Founder, Richard Sharp, Accepts Seat on Board of Cure Alzheimer’s Fund 3
... Aug. 25 announces that a new ... Protein Kinase Therapeutics in Oncology ... This report comprises defined ... protein kinase drugs (990 projects) within the portfolio ...
... KONG, Aug. 25 bioserie is first to market ... give earth-conscious Apple device owners the protection they demand ... production. bioserie,s unique use of the latest in bioplastics ... and the prevention of environmental toxic pollution once the ...
... meet three goals in the production of biofuels ... production and ecological sustainability. Syracuse University,s Radhakrishna Sureshkumar, ... in the L.C. Smith College of Engineering and ... Satvik Wani have uncovered a process that is ...
Cached Biology Technology:Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 2Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 3Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 4Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 5Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 6Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 7Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 8Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 9Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 10Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 11Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 12Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 13Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 14Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 15Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 16Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 17Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 18Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 19Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 20bioserie Introduces the World's First 'Made of Plants' iPhone 4 Cover 2SU research team uses nanobiotechnology-manipulated light particles to accelerate algae growth 2
(Date:11/18/2014)... --  News Highlights: , ... Partners Data Lake, an agile data and analytics ... allow researcher and clinicians to explore and develop ... of patients , The Partners Data Lake ... Partners system, breaking down physical barriers for collaboration ...
(Date:11/15/2014)... -- While we may still be a few years away from ... to gain instant access to all that ailed his patients, ... tablets for monitoring and measuring our health are cropping up ... a tad Orwellian to some, but a new survey suggests ... opportunities into their healthcare regime. These are some ...
(Date:11/10/2014)... appearing on U.S. store shelves in early 2010, and ... The small packets can be tossed into a washing ... or powder. The convenience, though, has come with risks ... at Nationwide Children,s Hospital found that from 2012 through ... children younger than 6 years of age swallowing, inhaling, ...
Breaking Biology News(10 mins):Partners HealthCare and EMC Unite to Solve Health Care's Toughest Challenges Using Big Data 2Partners HealthCare and EMC Unite to Solve Health Care's Toughest Challenges Using Big Data 3Partners HealthCare and EMC Unite to Solve Health Care's Toughest Challenges Using Big Data 4Partners HealthCare and EMC Unite to Solve Health Care's Toughest Challenges Using Big Data 5Americans May Be Ready for a Brave New World of Healthcare 2Americans May Be Ready for a Brave New World of Healthcare 3Americans May Be Ready for a Brave New World of Healthcare 4Study finds laundry detergent pods, serious poisoning risk for children 2
... For the first time, researchers have confirmed an association ... and abnormalities on brain MRI, according to a new ... The new study raises the possibility that a toxic ... body long after administration. Brain MRI exams ...
... Peterhans, a Roosevelt University professor and adjunct curator at ... mammals in Africa, has announced the discovery of four ... of the Democratic Republic of Congo. , The mammals ... led by the Wildlife Conservation Society (WCS) and in ...
... of millions of Americans, there,s no such thing as the ... hear a constant ringing, buzzing, hissing, humming or other noise ... be debilitating and life-altering. Now, University of Michigan ... what is going on inside their unquiet brains. The ...
Cached Biology News:Contrast agent linked with brain abnormalities on MRI 2Chicago scientist involved in discovery of 4 new mammal species in Democratic Republic of Congo 2U-M tinnitus discovery opens door to possible new treatment avenues 2U-M tinnitus discovery opens door to possible new treatment avenues 3
... Mouse monoclonal antibody raised against a partial ... (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant ... Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: ... AAH39825 OMIM: 154235, ...
Mouse polyclonal antibody raised against a partial recombinant DDEF2. NCBI Entrez Gene ID = 8853...
Mouse monoclonal antibody raised against a partial recombinant QARS. NCBI Entrez Gene ID = QARS...
Mouse monoclonal antibody raised against a partial recombinant QPCT. NCBI Entrez Gene ID = QPCT...
Biology Products: