Navigation Links
Research Tools for Analysis of ZAP-70

Activation of B cells through the B cell receptor or T cells through the CD3 complex follows a similar signaling pathway although, in many cases, different members of the same kinase families are used. ZAP-70 and Syk are members of the same family and have similar sequences and structures. Crosslinking of the CD3 receptor complex leads to the activation of Lck and Fyn which are Src family tyrosine kinases1,2. These kinases phosphorylate ITAM regions on the receptor which act as docking sites for ZAP-70. Phosphorylation of ZAP-70 by Lck leads to its activation. ZAP-70 then goes on to phosphorylate a number of adaptor proteins and helps activate other kinases as well as phospholipase Cγ. B cells are activated by crosslinking of the Ig receptor3. This activates Lyn, another member of the Src family. Through a similar sequence of events, Syk is activated. Syk is found in various hematopoietic cells such as B cells, platelets, macrophages, and mast cells. ZAP-70 is found primarily in T cells and is not expressed in normal B cells.

Chronic lymphocytic leukemia, a tumor of mature B cell origin, is one of the most common leukemias. The B cells of these donors express an unmutated variable region of the Ig heavy chain gene. More recent work has shown that these donors also express ZAP-70 and that this may be a better marker indicating the aggressive form of the disease4,5. Furthermore, it has been shown that signaling through the Ig receptor is better in ZAP-70 containing CLL cells as opposed to cells that only have Syk6. Responsiveness to anti-Ig is also increased in B cells transfected with ZAP-70.

Adding to our portfolio of ZAP-70 antibody reagents for flow cytometry, western blot, and IHC, BD Biosciences has developed a BD Cytometric Bead Array (CBA) Flex Set assay that measures total ZAP-70 from SDS denatured cell lysates. The BD CBA Flex Set assay utilizes an antibody-conjugated
'"/>

Source:


Page: All 1 2 3

Related biology technology :

1. The DIG System Nonradioactive Automated High-Throughput In Situ Hybridization: a Powerful Tool for Functional Genomics Research
2. Quantitation of the Protein MIA as a Marker for Chondrocytes in Research Samples
3. Control Your siRNA Research
4. Getting Started with MicroRNA Research
5. Monitoring Microbial Populations Using Real-Time qPCR on the MJ Research Opticon 2 System
6. Proteomics in Bladder Cancer Research: Protein Profiling of Bladder Squamous Cell Carcinomas, Rev C
7. Research Organics
8. A Robust LC/MS/MS Method for the Quantitation of Very Long Chain Fatty Acids for Research into the Characterization of Peroxisomal Disorders
9. A new LC/MS/MS Research Method for Rapid Quantitation of Five Immunosuppressant Drugs, including Mycophenolic Acid (MPA)
10. Technical Specifications Accelerating Your Research with the BD FACSCanto High Throughput Sampler Option
11. An Easy-to-Use Research Fermentor/Bioreactor
Post Your Comments:
*Name:
*Comment:
*Email:
TAG: Research Tools for Analysis ZAP

(Date:12/19/2014)... N.Y. , Dec. 18, 2014 Egenix, Inc. ... has been elected Chairman of the Board, to succeed ... and CEO, but will continue as a member of the ... he has added to the company over almost twenty years, ... The Board of Directors has established a Search Committee ...
(Date:12/17/2014)... USA (PRWEB) December 16, 2014 ... manager at Philipps- Universität Marburg’s Department of Physics, ... photonics, in the newly released SPIE Women ... never be too shy to ask questions.” , ... technology, engineering, and mathematics) occupations ranging from university ...
(Date:12/17/2014)... Xeno Diagnostics has again received ... recent COLA inspection. Xeno has met all criteria ... accreditation organization. Accreditation is earned only by laboratories ... operations, demonstrate continued accuracy in the performance of ... survey. , While the Laboratory Excellence ...
(Date:12/17/2014)... Md. , Dec. 17, 2014 CASI ... company dedicated to the acquisition, development and commercialization of ... for the global market with a primary commercial focus ... it has been granted a Type C meeting with ... the meeting will be held in February 2015.  During ...
Breaking Biology Technology:Network, Multitask, Persevere: SPIE Women in Optics Planner Subjects Share from Experience 2Network, Multitask, Persevere: SPIE Women in Optics Planner Subjects Share from Experience 3Xeno Diagnostics Receives 3rd Award for Laboratory Excellence 2CASI Pharmaceuticals Granted Type C Meeting With U.S. FDA For ENMD-2076 In Fibrolamellar Carcinoma 2CASI Pharmaceuticals Granted Type C Meeting With U.S. FDA For ENMD-2076 In Fibrolamellar Carcinoma 3CASI Pharmaceuticals Granted Type C Meeting With U.S. FDA For ENMD-2076 In Fibrolamellar Carcinoma 4CASI Pharmaceuticals Granted Type C Meeting With U.S. FDA For ENMD-2076 In Fibrolamellar Carcinoma 5
... BioMed Realty Trust, Inc. (NYSE: BMR ), a real ... Science Industry®, today announced financial results for the third quarter ended ... Generated record total revenues for the third quarter of ... in 2009. Increased rental revenues for the third quarter by ...
... to develop relatively advanced tools after their brains evolved a ... that investigates why it took early humans almost two million ... axe. Researchers used computer modelling and tiny sensors embedded ... humans needed in order to make two types of tools ...
... New Mexico, NOVEMBER 3, 2010Scientists at the U.S. Department ... Laboratory have fabricated transparent thin films capable of absorbing ... area. The material, described in the journal Chemistry ... transparent solar panels. "Potentially, with future refinement of ...
Cached Biology Technology:BioMed Realty Trust Reports Third Quarter 2010 Financial Results 2BioMed Realty Trust Reports Third Quarter 2010 Financial Results 3BioMed Realty Trust Reports Third Quarter 2010 Financial Results 4BioMed Realty Trust Reports Third Quarter 2010 Financial Results 5BioMed Realty Trust Reports Third Quarter 2010 Financial Results 6BioMed Realty Trust Reports Third Quarter 2010 Financial Results 7BioMed Realty Trust Reports Third Quarter 2010 Financial Results 8BioMed Realty Trust Reports Third Quarter 2010 Financial Results 9BioMed Realty Trust Reports Third Quarter 2010 Financial Results 10BioMed Realty Trust Reports Third Quarter 2010 Financial Results 11BioMed Realty Trust Reports Third Quarter 2010 Financial Results 12BioMed Realty Trust Reports Third Quarter 2010 Financial Results 13BioMed Realty Trust Reports Third Quarter 2010 Financial Results 14BioMed Realty Trust Reports Third Quarter 2010 Financial Results 15BioMed Realty Trust Reports Third Quarter 2010 Financial Results 16BioMed Realty Trust Reports Third Quarter 2010 Financial Results 17Stone Age humans needed more brain power to make big leap in tool design 2Scientists produce transparent, light-harvesting material 2
(Date:12/11/2014)... 2014  Data Sciences International (DSI), the global ... new series of digital telemetry implants to meet ... series, part of the PhysioTel™ Digital platform, was ... physiologic data when incorporating functional endpoints into repeat-dose ... toxicology studies has evolved from short ECG strips ...
(Date:12/10/2014)... DIEGO , Dec. 9, 2014 CIE ... collaboration catalyst that provides the connective tissue that enhances ... enabling them to easily share client-level information; earned a ... to expand to organizations serving seniors aging in community ... Diego" partner on December 11 th 4-6p. ...
(Date:12/5/2014)... , Dec. 4, 2014  Tute Genomics, a leader ... million in Series A1 funding led by UK-based Eurovestech. ... participated in the investment round. "We are ... community adopts next-generation sequencing and seeks new approaches for ... Reid Robison , MD MBA, and CEO of Tute ...
Breaking Biology News(10 mins):New telemetry implants expected to change how large animal toxicology studies are conducted 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 3Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 4Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 2Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 3
... You don,t need to spray weedkiller to remove the ... with either boiling water, steam or flaming will dispatch even ... a new PhD project from the University of Copenhagen. ... is important that each treatment is dosed correctly. Basically, ...
... Johns Hopkins scientists have engineered cells that behave like ... on one or more unique inputs. This feat, published in ... eventually help researchers create computers that use cells as tiny ... in the Department of Cell Biology and member of the ...
... BETHESDA, MD May 30, 2012 The Genetics Society ... six graduate students and seven postdoctoral researchers as recipients of ... Each of these early-career geneticists receives a $1,000 travel award ... in a laboratory course of their choice that will enhance ...
Cached Biology News:Blanch your weeds 2Training cells to perform Boolean functions? It's logical 2Training cells to perform Boolean functions? It's logical 3The Genetics Society of America announces DeLill Nasser Travel Award recipients 2
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... kit contains sufficient materials for 1,464 array sample elements. ... 4 each , Blocker BSA in PBS (10X): ... , BupH Phosphate Buffered Saline: 8 packs ... SuperSignal West Pico Luminol Enhancer: 2 x 25 ml ...
Biology Products: