Navigation Links
Reagents for Up and Down-Regulation of miRNA Activity in Mammalian Cells

). Interestingly, the cells transfected with the miR-31 inhibitor become elongated and display thin membrane protrusions similar in appearance to neurite outgrowths (Figure 5, left inset). The negative control data was identical to the nontransfected control (Figure 5, right inset). Additional screening experiments using groups of Pre-miR miRNA and Anti-miR miRNA Inhibitors will undoubtedly reveal miRNAs that are involved in a broad range of cellular processes.

Figure 5. Identification of miRNAs that Alter Cell Proliferation. HeLa cells (5 x 103) were transfected with individual Anti-miR miRNA Inhibitors in triplicate using siPORT NeoFX Transfection Agent (Ambion). 72 hr post-transfection, cells were fixed and stained with propidium iodide to count total cell number (TTP LabTech Acumen Exporer). Cells were then stained for -actin using immunofluorescence.

The horizontal shaded area represents the normal range of cell number for this cell type, as exemplified by cells transfected with a negative control that does not affect cell proliferation (second bar from the right). The right inset shows the morphology of these control cells. The left inset shows the morphology of cells transfected with an Anti-miR Inhibitor to miR-31.


Pre-miR miRNA and Anti-miR miRNA Inhibitors

We have developed ready-to-use synthetic precursor miRNAs and antisense miRNAs for use in transfection experiments. These are valuable tools for functional analyses of miRNA activity in a wide variety of biological systems. See www.ambion.com/miRNA
'"/>

Source:


Page: All 1 2 3 4 5 6 7 8 9

Related biology technology :

1. A Comparison Study of Lipid Tranfection Reagents in A549, NIH 3T3 and COS-7 Cell Lines
2. Total RNA Purification from Cultured Cells Using the ABI PRISM 6700 Automated Nucleic Acid Workstation and Total RNA Lysis Reagents
3. Achieving Reliable Protein Quantitation Results Using ICAT Reagents, MALDITOF Mass Spectrometry, and Advanced Data Interpretation Tool
4. Cancer-Related miRNAs Uncovered by the mirVana miRNA Microarray Platform
5. Detecting miRNA & siRNA
6. miRNA Expression in White Blood Cells
7. Isolate It All: siRNA miRNA Total RNA Native Protein
8. Get the miRNA OutPlant Applications
9. Novel MicroRNA Array Technology for Sensitive miRNA Profiling
10. pSilencer 4.1-CMV: Versatile Vectors for Expression of siRNA, miRNA, and mRNA
11. Precursor miRNAs for Successful miRNA Functional Studies
Post Your Comments:
*Name:
*Comment:
*Email:
TAG: Reagents for and Down Regulation miRNA Activity Mammalian Cells

(Date:11/18/2014)... (PRWEB) November 18, 2014 Brothers Josh ... the launch of PAWSitively Curing Cancer, Inc . ... new 501(c) (3) non-profit organization is dedicated to raising ... goes directly to the University of Florida College ... with PAWSitively Curing Cancer as the recipient of this ...
(Date:11/18/2014)... 2014  Great Basin Scientific, Inc. (NASDAQ: GBSN ... will host a conference call and webcast to provide an ... Nov. 20, at 4:30 pm EST time. "We ... Company,s recent IPO and would like to provide our investors ... Ryan Ashton , President and Chief Executive Officer of Great ...
(Date:11/16/2014)... 2014 James Hill and Ken Crooks ... Hoods, 3 Years Later” scheduled for Thursday, November 20, ... Butler University surprised many in the lab design domain ... chemistry and general chemistry teaching laboratories at Gallahue Hall. ... age and substantial growth within the chemistry program. Now, ...
(Date:11/15/2014)... Denver, Colorado (PRWEB) November 14, 2014 ... leading provider of proprietary, cloud-based analytics, and scientific ... results for the third quarter ended September 30, ... Quarter 2014 Highlights, ,     CannLabs – ... in Las Vegas, Nevada. ,     CannLabs – ...
Breaking Biology Technology:PAWSitively Curing Cancer, Inc. Launched By Two Children for National Pet Cancer Awareness Month 2PAWSitively Curing Cancer, Inc. Launched By Two Children for National Pet Cancer Awareness Month 3Great Basin Scientific Announces Conference Call to Provide Update on Corporate Progress 2Don't miss the I2SL High-Tech Talks Webinar Series Presenting: Butler University's Renovation With Filtered Fume Hoods, 3 Years Later 2Don't miss the I2SL High-Tech Talks Webinar Series Presenting: Butler University's Renovation With Filtered Fume Hoods, 3 Years Later 3CannLabs Announces Third Quarter 2014 Results. 2CannLabs Announces Third Quarter 2014 Results. 3CannLabs Announces Third Quarter 2014 Results. 4CannLabs Announces Third Quarter 2014 Results. 5
... president of Niceware International , a Milwaukee developer ... Matter has seen identification software used to track parts ... only a matter of time before healthcare facilities came ... founded in 2002, has produced NiceLabel software for the ...
... - In a criminal trial, as any fan of TV ... defense goes second. The accused can appear in deep trouble, at ... often carries the day. , ,Not only does that make for ... works in real life. Those who file the charges speak first, ...
... Milwaukee, Wis . - Midwest Fiber Networks , which ... by March of 2008, has been granted a reprieve by ... the project. , ,The council has voted to give Midwest ... or demonstration area, of the citywide wireless network. The company ...
Cached Biology Technology:Software company enters health space with RFID solutions on hold 2Software company enters health space with RFID solutions on hold 3Here's why Wisconsin's stem cell patents are being challenged 2Here's why Wisconsin's stem cell patents are being challenged 3Here's why Wisconsin's stem cell patents are being challenged 4
(Date:11/2/2014)... World , James Dacey explores the ways in which ... their innovations from the lab into the commercial market. ... start-up companies as they move from prototype to product ... factors: physics-based inventions are usually far from market-ready when ... a lot more complicated than had been originally thought. ...
(Date:11/2/2014)... Feynman walk into a bar and bump into a biologist ... setup to some late-night nerd sketch, researchers have taken this ... modern biology, namely, finding meaning in the rising oceans of ... of cancer mutations that genome-wide studies are publishing at a ... to parse the signal from the noise (and there is ...
(Date:10/31/2014)... still live in Nuristan Province – some 60 years ... scent glands are more valuable than gold , Study ... Oryx , NEW YORK (October 31, 2014) – ... a strange deer with vampire-like fangs still persists in ... a research team led by the Wildlife Conservation Society ...
Breaking Biology News(10 mins):The 'valley of death' facing physics start-ups 2Mutant models 2Mutant models 3Mutant models 4Strange, fanged deer persists in Afghanistan 2
... microbiologist James Holden of the University of Massachusetts Amherst launches ... the cracks and thermal vents around an undersea volcano, for ... will not be funded by a government source. ... oceanographic research: The Gordon and Betty Moore Foundation started by ...
... YORK , Aug. 16, 2013   EyeLock Inc. , a market ... Roger An as Vice President of Global Market ... research, analysis and strategic initiatives to further the embedded applications ... heavy focus on Asia .   ...
... CITY)If terrorists targeted the United States with an anthrax attack, ... such as knowing the likelihood of an individual becoming ... and how long to give antibiotics to protect people ... anthrax-laced letters killed five people and infected 17 others in ...
Cached Biology News:Google, Intel founders support undersea research by UMass Amherst microbiologist 2Google, Intel founders support undersea research by UMass Amherst microbiologist 3EyeLock Appoints Roger An Vice President of Global Market Development 2EyeLock Appoints Roger An Vice President of Global Market Development 3Answering crucial questions about anthrax exposure 2Answering crucial questions about anthrax exposure 3Answering crucial questions about anthrax exposure 4
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
...
... polyclonal antibody raised against a partial recombinant ... (AAH35357, 120 a.a. ~ 250 a.a) partial ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Mouse monoclonal antibody raised against a partial recombinant PRKG1. NCBI Entrez Gene ID = PRKG1...
Biology Products: