Navigation Links
Expression and Purification of Recombinant Proteins That Have Native Amino,,,Acid Sequence

ide gaps had been repaired in vivo by E. coli. This result confirms that there are no constraints on the location of the first adenine residue in the sequence of the insert DNA.

Expression and Purification of CBP Affinity-Tagged Fusion Proteins

The CBP affinity-tag system was used for expressing and purifying the JNK fusion protein from clones of the pCAL-n-EK vector containing the JNK insert ((pCAL-n-EK/JNK).). Epicurian Coli BL21(DE3) competent cells, which encode T7 RNA polymerase, were transformed with a pCAL-n-EK/JNK plasmid, and a culture was grown and induced according to a standard protocol.7 Lysates were prepared, incubated with calmodulin affinity resin, applied to a disposable column, washed with CaCl2 and eluted with 2 mM EGTA as described previously.1 Figure 3 shows the induced and uninduced sample, the calmodulin affinity resin flowthrough fraction depleted of the CBPJNK fusion protein (CBPJNK) and the fraction of pure, 52kDa, EGTAeluted CBPJNK.

Figure 3

Enterokinase Cleavage of the CBP Affinity Tag

The pCALnEK vector contains the 5-amino-acid target sequence for the site-specific protease EK to allow removal of the CBP affinity tag following purification of the fusion protein. Cleavage with EK results in recombinant proteins that contain no extraneous amino acids. Stratagene offers purified recombinant Enterokinase, which exhibits high specific activity and is free of contaminating proteases. Each order of Enterokinase is provided with Soybean Trypsin Inhibitor Agarose. (See the accompanying article in this newsletter, pages 2425, for a description of treating the purified JNK fusion protein with EK. This arti
'"/>

Source:


Page: All 1 2 3 4 5 6 7 8

Related biology technology :

1. An Epitope Tagging Vector for Gene Expression in Mammalian Cells
2. Antibodies for Studying NMDA Receptor Protein Expression and Synapse-Specific Immunolabeling
3. High-Level Expression of Peanut Allergens Affected by Rare Codon Usage
4. Versatile Vectors for Ponasterone A- Inducible Control of Gene Expression in Mammalian Cells
5. Innovative Tissue Array Technology for High-Throughput Screening of Gene Expression
6. New Mammalian Expression Vectors Employ Stable, High-Level Fluorescence Humanized Renilla GFP Reporter
7. Functional Cloning Using ViraPort Retroviral cDNA Expression Libraries
8. High-Level Protein Expression, One-Column Purification, and FLAG Epitope Tagging in E. coli
9. A New Lambda Vector for Mammalian Expression
10. Codon Bias-Adjusted BL21 Derivatives for Protein Expression
11. Tools for Detecting MSH2 Expression in Chinese Hamster Ovary Cells
Post Your Comments:
(Date:1/22/2015)... 2015 Protocol Networks brings independent technology ... of brand-neutral, independent consultants, Protocol Networks has recently announced ... over the years, his company has attracted several clients ... Plainfield, as well as others. With the success of ...
(Date:1/22/2015)... Pipette.com has added the Eppendorf ... portfolio of Eppendorf products. , The Eppendorf Centrifuge 5424/5424 ... 5424/5424 R and receive the following:, , ... or Eppendorf Reference 2 ,     3 Free ...
(Date:1/22/2015)... Madison, WI (PRWEB) January 22, 2015 Dr. ... at the 12th annual Scripps Natural Supplements Pre-Conference seminar on ... Supplements Conference is an annual continuing education conference for health ... 15th and included the topic of probiotics in health. Dr. ...
(Date:1/22/2015)... January 22, 2015 Selexis SA, a ... Research Cell Banks (RCBs) used for drug discovery to ... Banks will include Next-Generation Sequencing (NGS) data ... de-risks biologic manufacturing by ensuring the integrity of the ...
Breaking Biology Technology:Protocol Networks Brings Independent Technology Consulting to the Constitution State 2Eppendorf Announces Promotional Bundle Which Includes: Eppendorf Centrifuge 5424, 3-Pack of Pipettes, and Tips - Available Now at Pipette.com 2Selexis Generated Research Cell Banks Now Fully Sequenced Using Next-Generation Sequencing 2
... AUSTIN, Texas and TORONTO, Oct. 3 Two ... to integrate vibration,therapy into the stem cell harvesting ... company based in Austin,Texas, has signed an exclusive ... of Toronto, Ontario. The partnership,between the two companies ...
... ),AMDL, Inc. (Amex: ADL ), a leading vertically ... US, today announced that the,Company will present at the ... Tuesday, October 7, 2008 at 10:30 a.m. ET. AMDL,s ... Hotel in the Morosco Room., The Maxim Group ...
... Stock Exchange Symbol: MS, EDMONTON, Oct. 3 ... developer in the treatment of multiple sclerosis (MS), ... (DSMB) for the,Company,s U.S. pivotal phase III MAESTRO-03 ... MS has completed a safety analysis,and recommended that ...
Cached Biology Technology:New Partnership Integrates Vibration Therapy Into Stem Cell Procedures 2New Partnership Integrates Vibration Therapy Into Stem Cell Procedures 3AMDL, Inc. to Present at Maxim Group Growth Conference October 7, 2008 2AMDL, Inc. to Present at Maxim Group Growth Conference October 7, 2008 3BioMS Medical's phase III U.S. multiple sclerosis trial receives positive safety review from Data Safety Monitoring Board 2
(Date:12/24/2014)... its launch in December 2014, the 1U™ app ... trying to remember their usernames and passwords through replacing the ... To assist people who have struggled to remember usernames and ... and focuses on redefining identity, announced today that it is ...
(Date:12/22/2014)... DUBLIN , Dec. 22, 2014 Research and ... the addition of the "The Global Watermarking ... http://photos.prnewswire.com/prnh/20130307/600769 ... global digital media watermarking and fingerprinting markets. Watermarking ...
(Date:12/19/2014)... , Dec. 18, 2014 Research and Markets ... "iPhone 5S Fingerprint Sensor - Apple/AuthenTec TMDR92 & ... http://photos.prnewswire.com/prnh/20130307/600769 ... introduced the fingerprint reading feature with the iPhone 5S. ...
Breaking Biology News(10 mins):1U Offers Best Solution to the Username / Password Dilemma: For FREE! 21U Offers Best Solution to the Username / Password Dilemma: For FREE! 3The Global Watermarking and Fingerprinting Markets 2iPhone 5S Fingerprint Sensor - Apple/AuthenTec TMDR92 & Sapphire - Technology Report 2
... in a group of heat-loving bacteria by researchers at ... light a fire under next-generation biofuel production. Scientists ... to break down complex plant material such as switchgrass ... make biofuels. Conventional processes involve the addition of commercially ...
... faded since the end of the Cold War, existing ... devastating global impacts. Researchers at the University of ... effects of a hypothetical nuclear war between India and ... in distant countries. The work, by Mutlu Ozdogan ...
... in our bodies. This process is driven by microtubule filaments ... so-called motor proteins in the cytosol can control their dynamics. ... of cell division. It is composed in large part of ... size, shape and mobility of a cell. In a new ...
Cached Biology News:BESC researchers tap into genetic reservoir of heat-loving bacteria 2War-related climate change would reduce substantially reduce crop yields 2
... for high-yield protein expression ,The ... a high-yielding clone of Sf9 cells. Pre-adapted ... Cell Medium, these cells are recommended for ... baculovirus infection or transfection of appropriate vectors. ...
... Mouse monoclonal antibody raised against a partial recombinant ... 358 a.a. ~ 457 a.a) partial recombinant protein ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
Mouse polyclonal antibody raised against a partial recombinant DDEF2. NCBI Entrez Gene ID = 8853...
Mouse monoclonal antibody raised against a partial recombinant QARS. NCBI Entrez Gene ID = QARS...
Biology Products: