Navigation Links
Differential Gene Expression Analysis of Pure Cell Populations from Frozen UterineTissue Using Laser Capture Microdissection (LCM) and cDNA Microarrays

d to metabolism (3), gene/protein expression (1), and signal transduction (1) (data not shown). Among those 58 genes with known functions and are expressed at both IM and INTER sites, 13 (22.4%) genes were associated with Ca2+ for their functions and/or regulations.


Conclusions
In the present study, we compared the gene expression profiles of the luminal epithelial endometrium of implantation (IM) and interimplantation (INTER) sites to elucidate the genes involved in the process of embryo apposition prior to implantation using LCM, linear amplification of RNA and microarray analysis. The nature of these genes suggest and that active tissue remodeling is in progress at the implantation sites before the embryonic attachment. Further, we propose that Ca2+ is a crucial regulatory factor, actively involved in this process. The list of genes identified may provide information regarding molecular mechanisms occurring at the implantation sites before embryo attachment and regulated by various embryonic factors.


References
1 Reese, J., Das, S.K., Paria, B.C., Lim, H., Song, H., Matsumoto, H., Knudtson, K.L., DuBois, R.N., Dey, S.K. (2001) Global gene expression analysis to identify molecular markers of uterine receptivity and embryo implantation. J Biol Chem, 276, 4413744145.

2 Carson, D.D., Lagow, E., Thathiah, A., Al-Shami, R., Farach-Carson, M.C., Vernon, M., Yuan, L., Fritz, M.A., Lessey, during the early to mid-luteal (receptive phase) transition in human endometrium detected by high-density microarray screening. Mol Human Reprod, 8, 871-879.

3 Yoon, S.J., Choi, D.H., Lee, W.S., Cha, K.Y., Kim, S.N., Lee, K.A. (2004) A molecular basis for embryo apposition at the luminal epithelium. Mol Cell Endocrinol, 219, 95-104.

The data described herein has been published, in part, in Yoon et al.,
'"/>

Source:


Page: All 1 2 3 4 5 6 7 8

Related biology technology :

1. Fractionating DNA Fragments Generated by Differential Display PCR
2. Identification of Differentially Expressed Gene Products with the CastAway System*
3. An Epitope Tagging Vector for Gene Expression in Mammalian Cells
4. Antibodies for Studying NMDA Receptor Protein Expression and Synapse-Specific Immunolabeling
5. High-Level Expression of Peanut Allergens Affected by Rare Codon Usage
6. Versatile Vectors for Ponasterone A- Inducible Control of Gene Expression in Mammalian Cells
7. Innovative Tissue Array Technology for High-Throughput Screening of Gene Expression
8. New Mammalian Expression Vectors Employ Stable, High-Level Fluorescence Humanized Renilla GFP Reporter
9. Functional Cloning Using ViraPort Retroviral cDNA Expression Libraries
10. High-Level Protein Expression, One-Column Purification, and FLAG Epitope Tagging in E. coli
11. A New Lambda Vector for Mammalian Expression
Post Your Comments:
(Date:6/18/2013)... June 18, 2013 The human skin is ... as an important human body part. Similar to the liver, ... order to function, repair and grow. Recent reports from the ... supplements, is just as important as other life supporting organs. ... aid in skin cell reproduction, increase the appearance of skin, ...
(Date:6/18/2013)... , June 18, 2013 ... using the company,s  proprietary AMCA Guided Bone Regeneration (GBR) Dental ... implants. A common problem encountered when patients have ... of sufficient bone volume to house the implant. Consequently there ... bone substitute until the natural bone regenerates. The bone substitute ...
(Date:6/18/2013)... June 18, 2013 ... research firm, announces the initiation of full ... biopharmaceutical company developing and marketing products for ...      (Logo: http://photos.prnewswire.com/prnh/20130417/608168) ... examining the investment merits of BioAlliance Pharma, ...
(Date:6/18/2013)... , June 18, 2013 Mapi ... (APIs), generic and innovative intermediates, and finished dosage forms based ... has been granted a United States ... Europe for the oral treatment of ... is titled Intermediate Compounds and Processes for the Preparation ...
Breaking Biology Technology:Natural Acne Remedies Through Diet, Probiotic Action Shares New Insight on What Foods May Help Lead to Clear Skin 2RegeneCure Starts Clinical Study Using Polymeric Bone Stimulating Membrane for Dental Implants 2RegeneCure Starts Clinical Study Using Polymeric Bone Stimulating Membrane for Dental Implants 3Edison Expands French Healthcare Sector Coverage With Initiation of Coverage on BioAlliance Pharma 2Edison Expands French Healthcare Sector Coverage With Initiation of Coverage on BioAlliance Pharma 3Mapi Pharma Granted United States Patent for Pain Relief Medication "Tapentadol" 2
... Calif., May 8 Edwards Lifesciences,Corporation (NYSE: EW ... valves,announced that the company will celebrate a number of ... meeting of the American,Association for Thoracic Surgery (AATS), May ... by Edwards -- which this year celebrates,its 50th anniversary ...
... ALTO, Calif., May 8 Telik, Inc. (Nasdaq:,TELK) today ... per share, for,the first quarter ended March 31, 2008, ... per share, for the comparable period in 2007., ... costs and,expenses were $10.6 million, compared with $18.0 million ...
... Md., May 8 The Maryland Stem Cell,Research ... 122,applications in response to its three official Requests ... Maryland Technology Development,Corporation (TEDCO) reviewed the Commission,s recommendations ... Maryland Stem Cell Research,Fund (MSCRF) under the Maryland ...
Cached Biology Technology:Edwards Lifesciences Celebrates One Million Heart Valve Patients and More at AATS 2008 2Edwards Lifesciences Celebrates One Million Heart Valve Patients and More at AATS 2008 3Edwards Lifesciences Celebrates One Million Heart Valve Patients and More at AATS 2008 4Telik Announces First Quarter 2008 Financial Results 2Telik Announces First Quarter 2008 Financial Results 3Maryland Stem Cell Research Commission Recommends 62 Projects for Funding 2Maryland Stem Cell Research Commission Recommends 62 Projects for Funding 3
(Date:6/19/2013)... Course at the Marine Biological Laboratory (MBL), Woods ... Microbiology site by the American Society for Microbiology ... recognizes institutions and the scientists who worked there ... science of microbiology. A ceremony unveiling the ... for Saturday, June 22, 2013, at 4:30 pm ...
(Date:6/19/2013)... University of Pittsburgh has developed antibacterial compounds, derived ... be potential treatments for drug-resistant bacterial infections and ... are quite small, making them inexpensive and easy ... June 2013 issue of the journal Antimicrobial ... many probable applications will likely be the chronic ...
(Date:6/19/2013)... June 19, 2013 A decade-long JDRF-funded study ... Helmholtz Zentrum Mnchen, Germany, is providing a deeper ... risk of developing type 1 diabetes (T1D), highlighting ... for the disease. The study, "Seroconversion to Multiple ... in Children," was published today in The ...
Breaking Biology News(10 mins):Microbial diversity course designated as a 'Milestones in Microbiology' site 2HIV-derived antibacterial shows promise against drug-resistant bacteria 2New data on islet autoantibodies in young children defines early type 1 diabetes development 2
... that the loss of a gene called p63 accelerates aging ... many organisms, including humans. Therefore, the p63 gene is likely ... "To study how the p63 gene works, we devised a ... us right away was that these p63 deficient mice were ...
... study has followed a single humpback whale from one ... the migratory patterns of these majestic marine mammals in ... Society (WCS), the American Museum of Natural History (AMNH), ... Society's Biology Letters, a male humpback whale that was ...
... the introduction of the varicella (chicken pox) vaccine in ... have dropped dramatically, according to a study in the ... recommended for routine immunization of children aged 12 to ... in the United States, according to background information in ...
Cached Biology News:Gene loss accelerates aging 2Genetics links whale to two different ocean basins 2Hospitalizations because of chicken pox down dramatically since implementation of vaccine 2Hospitalizations because of chicken pox down dramatically since implementation of vaccine 3
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...
Rabbit polyclonal antibody to GluR2...
Biology Products: