Navigation Links
Delivery of pCMV-S DNA Using the Helios Gene Gun System Is Superior to Intramuscular Injection in Balb/c Mice

Andrew Conn, Lindy Durrant, and Ian Spendlove, Cancer Research Campaign Academic Unit, Nottingham City Hospital, Hucknall Road, Nottingham NG5 1PB, UK


Introduction
Gene gun immunization through the skin is a reliable and reproducible method of DNA vaccine delivery, and has been shown to be capable of inducing protective immunity in animal models to both infectious diseases and cancer (Chen et al. 2000, Chen et al. 1999). Delivery of DNA using the gene gun is a highly efficient method of achieving antigen presentation, and, as a result, immunizations require 2502,500 times less DNA than standard intramuscular delivery (Fynan et al. 1993). This is due to the dense network of Langerhans cells that are found in the epidermis, acting as a source of antigen-presenting cells.

Bio-Rads Helios gene gun system delivers DNA to the epidermis using helium-driven bombardment of DNA-coated gold microparticles. The nature of immune responses generated following vaccination with DNA depends on a number of key factors, such as the route, method, and vaccination schedule employed. We have therefore performed a series of pilot experiments with a DNA plasmid that encodes the hepatitis B surface antigen (HBsAg) to investigate the use of the Helios gene gun system in a Balb/c mouse model. A comparison has been made between delivery of this plasmid by gene gun and by intramuscular injection.


Methods
Plasmids
The pCMV-S plasmid encoding the HBsAg subtype ayw was kindly provided by Dr Robert Whalen, Maxygen, USA. DNA was prepared using the QIAGEN EndoFree Plasmid Mega kit. The presence of the HBsAg insert was verified by restriction enzyme digestion using BamHI and analysis by agarose gel electrophoresis.

Preparation of DNA-Coated Gold Microcarriers
On the day prior to vaccination, pCMV-S plasmid DNA was precipitated onto gold microcarriers as detailed in the Helios gene gun system instruction manual. Briefly, 8.3 mg of 1 m gold microcarriers was resuspended by sonication in 100 l of 0.05 M spermidine. Eighteen micrograms (18 g) of DNA at a concentration of 1 mg/ml in endotoxin-free water was then added and sonicated; 100 l of 1 M CaCl2 was then added dropwise. This gold-DNA mixture was allowed to stand for 10 min before being washed 3 times in 250 l of 100% ethanol. After the final wash, the pellet was resuspended in 200 l of 0.025 mg/ml polyvinylpyrrolidone (PVP) in 100% ethanol, transferred to a 15 ml tube, and made up to 1 ml with PVP/ethanol. This resulted in a microcarrier loading quantity (MLQ) of 0.5 mg of gold per shot and a DNA loading ratio (DLR) of 2 g/mg gold, which results in the delivery of 1 g of DNA per shot.

Loading DNA/Microcarrier Suspension into GoldCoat Tubing
This was performed as detailed in the Helios gene gun system instruction manual, with 1 ml of DNA/microcarrier suspension being used to produce 17 coated 0.5-inch cartridges, which were then stored overnight at 4C with desiccant prior to use.

Vaccination of Mice
Female Balb/c strain mice aged 68 weeks were obtained from Charles River, UK, and housed at the Biomedical Services Unit, University of Nottingham, UK.

For gene gun delivery, the abdominal fur of each mouse was removed with electric clippers prior to each vaccination. The barrel liner of the Helios gene gun was then held directly against the abdominal skin, and a single DNA/microcarrier shot delivered using a helium pressure of 400 psi.

For intramuscular delivery, 100 g of pCMV-S DNA in endotoxin-free water with 0.2 M CpG oligonucleotide was administered into the quadriceps muscle using a 1 ml insulin syringe. Mice were not anesthetized and the muscle was not pretreated prior to vaccination.

Vaccination Protocols
Two separate experiments were undertaken to assess DNA delivery by the Helios gene gun.

In the first experiment, one or two vaccinations by gene gun delivery were compared to the intramuscular route. Two groups of six mice received one pCMV-S DNA vaccination by either gene gun or intramuscular delivery. Another two groups of six mice received one pCMV-S DNA vaccination each at weeks 0 and 2 by either gene gun or intramuscular delivery. Antisera were then obtained at week 4 by postmortem cardiac puncture.

In the second experiment, the duration and degree of antibody response generated following two gene gun vaccinations was investigated. Six mice received one pCMV-S vaccination each by gene gun at weeks 0 and 2, and then antisera were obtained by tail bleeds at weeks 4, 6, 9, and 12 after vaccination.

ELISA to Show Antibody Response to pCMV-S DNA Vaccination
ELISA was performed as described by Davis et al. (1996). Microplates (96-well) were coated with 100 l of 1 g/ml HBsAg subtype ayw (Rhein Biotech, Dusseldorf, Germany) and stored at 4C overnight. Plates were then washed twice in phosphate buffered saline (PBS) containing 0.1% Tween 20, and blocked with 200 l of 10% fetal calf serum (FCS) in carbonate/bicarbonate buffer pH 9.6 (0.159 g Na2CO3 and 0.293 g NaHCO3 in 100 ml distilled water). Tenfold serial dilutions (1:10 to 1:10,000) of antisera from the immunized mice were made in PBS, 10% FCS, 0.05% Tween 20. After the plates were washed again 5 times in the previous wash solution, 100 l of each serial dilution was added to the wells, and the plates were incubated at room temperature for 1 hr. Following five more washes, 100 l of 1:1,000 rabbit anti-mouse-HRP (Serotec Ltd, Oxford, UK) in PBS, 10% FCS, 0.05% Tween 20 was added to each well and the plates incubated at room temperature for 1 hr. Plates were then washed 5 times before adding 150 l of ABTS substrate solution and reading the absorbance at 405 nm.

ELISA to Show Antibody Subclass Following pCMV-S DNA Vaccination
ELISA was performed as described above with the exception that the rabbit anti-mouse HRP antibody was replaced with 100 l of 1:1,000 goat anti-mouse IgG1-HRP or 1:1,000 goat anti-mouse IgG2a-HRP antibodies (Serotec Ltd) in order to detect the subclass of antibody response generated.

To determine the relative affinities of the anti-IgG1 and anti-IgG2a antibodies, a 96-well plate was coated with 50 l of 1:1,000 rabbit anti-mouse immunoglobulins (Dako, Ely, UK) and stored at 4C overnight. Fifty microliters (50 l) of the control IgG1 antibody 730 and IgG2a antibody 1143B7 were then added at concentrations of 10, 3, 1, 0.3, 0.1, 0.03, and 0.01 g/ml and the plates incubated at room temperature for 1 hr. Next, 50 l of 1:1,000 rabbit anti-mouse-HRP antibody was added and the plates incubated for 1 hr at room temperature. ABTS substrate solution (150 l) was then added and absorbance read at 405 nm.

Results
Intramuscular Vaccination
None of the six mice that received a single intramuscular vaccination developed an antibody response to the HBsAg. However, a response was obtained in four of six mice (detected at a 1:10 antiserum dilution) following two intramuscular vaccinations (Figure 1).

Gene Gun Vaccination
Four of six mice that received a single Helios gene gun vaccination developed an antibody response to the HBsAg (detected at a 1:10 antiserum dilution), with one of these responses measured at a dilution of 1:100. All six mice that received two gene gun vaccinations demonstrated antibody responses, detectable at an antiserum dilution of 1:10,000 for two mice, 1:1,000 dilution for three mice, and 1:100 dilution for one mouse, respectively (Figure 2).

Antibody Response by Subclass
The relative binding activity of the anti-IgG1 antibody was greater than that of the anti-IgG2a antibody. After taking this into account, we found that intramuscular vaccination with pCMV-S resulted in a predominantly IgG2a response, while Helios gene gun vaccination resulted in a predominantly IgG1 response (Figure 3).

Duration of Antibody Response Antisera obtained at weeks 4, 6, 9, and 12 after gene gun vaccination were all assessed by ELISA for the presence of antibodies to HBsAg. At all time points there was a significantly higher antibody titer compared to unimmunized control sera at a dilution of 1:1,000 (Figure 4). Antibody titers for the week 12 antisera are shown in Figure 5.


Discussion
Delivery of the pCMV-S plasmid using the Helios gene gun system was a simple and efficient method of DNA vaccination in Balb/c mice. In these pilot experiments, gene gun delivery consistently produced a higher antibody response rate to vaccination than the intramuscular route.

A single gene gun vaccination resulted in an antibody response against the antigen (measured at 1:10 dilution of antisera) in 66% (four out of six) of mice, this being equal to the response frequency observed with two intramuscular vaccinations. Following two gene gun vaccinations, all mice developed prolonged antibody titers that were detectable at 1:1,000 antiserum dilutions and had not declined at week 12. In contrast, two intramuscular vaccinations resulted in at least 100-fold lower titers of antibody, and in only 66% (four out of six) of mice.

The isotype of an antibody is often a good indication of the direction in which the immune response has developed. The IgG antibody subclass produced in response to intramuscular pCMV-S delivery was predominantly IgG2a. This is indicative of the T helper class 1 pathway (Th1). With Helios gene gun delivery of pCMV-S, the subclass produced tended towards IgG1, suggesting an antibody-based immune response mediated by the T helper class 2 pathway (Th2). This is consistent with previous experiments using the pCMV-S plasmid (McCluskie et al. 1999). The bias toward a Th1 or Th2 response following DNA gene gun delivery appears to vary according to different reports and may be a consequence of the encoded antigen and the makeup of the DNA construct.

This pilot study has allowed us to compare intramuscular vs. gene gun-mediated, intradermal immunization. It has demonstrated the reliability and ease of use of biolistic delivery, as well as the ability of biolistic delivery to generate specific long-lived immune responses. Future work will further elucidate the diversity of the immune responses that are generated following DNA delivery of the pCMV-S plasmid using the Helios gene gun system. In particular, future work will investigate whether pCMV-S vaccination by gene gun is able to stimulate cell-mediated immune responses in addition to the humoral responses demonstrated in our work to date. The IPQSLDSWWTSL peptide containing the dodecameric class I Ld-restricted epitope of the hepatitis B envelope will be used in cytotoxic T cell assays and tetramer analysis. This not only allows the generation of standardized assays, but also provides a control against which other vaccines can be tested.


Conclusion

Delivery of the pCMV-S plasmid using the Helios gene gun produced titers of antibodies against HBsAg that were up to 1,000 times greater than those observed with intramuscular vaccination. Antibody responses following gene gun delivery of pCMV-S were long-lived and did not decline for at least 12 weeks after initial vaccination. The Helios gene gun system represents a reliable and reproducible method of DNA vaccination, which, when used to deliver the pCMV-S plasmid, results in sustained high antibody titers.


References
Chen CH et al., Gene gun-mediated DNA vaccination induces antitumor immunity against human papillomavirus type 16 E7-expressing murine tumor metastases in the liver and lungs, Gene Ther 6, 19721981 (1999)

Chen Z et al., Cross-protection against a lethal influenza virus infection by DNA vaccine to neuraminidase, Vaccine 18, 32143222 (2000)

Davis HL et al., DNA vaccine for hepatitis B: evidence for immunogenicity in chimpanzees and comparison with other vaccines, Proc Natl Acad Sci USA 93, 72137218 (1996)

Fynan EF et al., DNA vaccines: protective immunizations by parenteral, mucosal, and gene-gun inoculations, Proc Natl Acad Sci USA 90, 1147811482 (1993)

McCluskie MJ et al., Route and method of delivery of DNA vaccine influence immune responses in mice and non-human primates, Mol Med 5, 287300 (1999)


Tween is a trademark of ICI Americas, Inc.


back to top
'"/>

Source:


Page: All 1 2 3 4 5 6 7 8

Related biology technology :

1. pFB-ERV: Retroviral Delivery of the Ecdysone Receptor Proteins
2. High-Titer Retroviral Vectors for Gene Delivery
3. A New Way to Assess siRNA Delivery Efficiency
4. Efficient Delivery of siRNAs to Human Primary Cells: Electroporation vs. Chemical Transfection
5. Enhanced siRNA Delivery and Long-term Gene Silencing
6. High Throughput siRNA Delivery In Vitro: From Cell Lines to Primary Cells
7. Low Abundance cDNA Cloned Using Stratagenes Human Universal cDNA Library
8. Oil-Free PCR Using the Hot Top Assembly
9. Functional Cloning Using ViraPort Retroviral cDNA Expression Libraries
10. Signal Transduction Reporting Systems Using Cis-Acting Enhancer Elements
11. Using XL1-Red Mutator Strain to Generate Esterase Variants
Post Your Comments:
(Date:6/19/2013)... 19, 2013  Continuing its long history of proven ... Beckman Coulter , Inc. announces the U.S. Food and ... AccuTnI+3 troponin I assay for use on its Access ... on Beckman Coulter,s troponin I test for ... the proven performance to continue providing dependability to laboratories ...
(Date:6/19/2013)... Bayer CropScience will honor Illinois beekeeper Steve McNair ... Award. The award will be announced at Bayer’s ... an event where supporters of pollinator health celebrate the ... , The Bayer Bee Care Community Leadership Award recognizes ... bee colony to benefit their community. Applicants are judged ...
(Date:6/19/2013)... LOS ANGELES , June 19, 2013 Biotechnology ... is teaming up with financial software provider BlackLine Systems ... (NYSE: SAP ) for a webinar next week ... Amgen Uses Solutions from BlackLine and SAP to Help Keep ... (Logo: http://photos.prnewswire.com/prnh/20061117/LAF027LOGO ) The webinar, ...
(Date:6/19/2013)... Indiana (PRWEB) June 19, 2013 ... joined the speaking faculty at 2013’s BioLogistics Summit ... The conference, coordinated by Cold Chain IQ and ... biologics. This “complexity” is, in part, attributed to ... , “Implicit within these trends is an ...
Breaking Biology Technology:Beckman Coulter Announces FDA Clearance of New Access AccuTnI+3 Troponin I Assay for the Access 2 Immunoassay System 2Beckman Coulter Announces FDA Clearance of New Access AccuTnI+3 Troponin I Assay for the Access 2 Immunoassay System 3Community Mentor Wins Inaugural Bayer CropScience Bee Care Leadership Award 2Community Mentor Wins Inaugural Bayer CropScience Bee Care Leadership Award 3Community Mentor Wins Inaugural Bayer CropScience Bee Care Leadership Award 4Amgen Joins BlackLine Systems, SAP for Webinar on Automating Account Reconciliations 2Amgen Joins BlackLine Systems, SAP for Webinar on Automating Account Reconciliations 3Amgen Joins BlackLine Systems, SAP for Webinar on Automating Account Reconciliations 4BioConvergence® Presents at BioLogistics Summit on Risk Matrix for Biosamples during Shipment 2
... MOUNTAIN VIEW, Calif., Jan. 17, 2012  MAP Pharmaceuticals, Inc. (Nasdaq: ... James O,Shea to its Board of Directors. Mr. O,Shea brings ... product commercialization and operations. "We are privileged to ... time in the Company,s development as we focus our efforts ...
... 16, 2012 Luminex Corporation (Nasdaq: LMNX ) ... fourth quarter and full year 2011 on Monday, February 6, ... release after the close of trading. (Logo: ... conference call to discuss the operating highlights and financial results ...
... 2012 Elsevier, a world-leading provider ... services, announced today that its first bilingual platform of ... , is now available online. NursingChina ... available in China, featuring skills within specialties such ...
Cached Biology Technology:MAP Pharmaceuticals Appoints W. James O'Shea to Board of Directors 2MAP Pharmaceuticals Appoints W. James O'Shea to Board of Directors 3Luminex Corporation Fourth Quarter and Full Year 2011 Earnings Release Scheduled for February 6, 2012 2Luminex Corporation Fourth Quarter and Full Year 2011 Earnings Release Scheduled for February 6, 2012 3Elsevier Launches Bilingual International Nursing Skill Training and Management Platform: NursingChina.com 2Elsevier Launches Bilingual International Nursing Skill Training and Management Platform: NursingChina.com 3
(Date:6/19/2013)... MOUNTAIN VIEW, Calif. , June 20, 2013 ... the personalized cosmeceuticals market, Frost & Sullivan recognizes ... Sullivan Award for New Product Innovation. geneOnyx leverages ... point-of-care testing to create an on-the-spot genetic test ... only a single-step DNA collection procedure from saliva ...
(Date:6/19/2013)... is playing a vital role in the survival of ... to climate and environmental changes, according to new research ... savannah birds from the Tanzanian Bird Atlas project - ... - the researchers found that they are using protected ... further west where dry seasons are getting longer, with ...
(Date:6/19/2013)... 19, 2013   Mercy Medical Center ... technology for conducting on-demand, Hemoglobin A 1c ... well as analysis of important red blood ... The new system enables the hospital to ... physicians and their patients, which can improve ...
Breaking Biology News(10 mins):Frost & Sullivan Applauds geneOnyx for its DNA Testing Solution for the Personalized Cosmeceuticals Market 2Frost & Sullivan Applauds geneOnyx for its DNA Testing Solution for the Personalized Cosmeceuticals Market 3Frost & Sullivan Applauds geneOnyx for its DNA Testing Solution for the Personalized Cosmeceuticals Market 4Protected areas provide African birds with stepping stones to survival 2Mercy Lab Offers Faster On-demand Diabetes Testing, Cellular Studies 2Mercy Lab Offers Faster On-demand Diabetes Testing, Cellular Studies 3Mercy Lab Offers Faster On-demand Diabetes Testing, Cellular Studies 4
... in biomedical science are on the horizon with ... Infrastructure (Instruct) in support of European biomedical research. ... (ESFRI) is involved in establishing about 40 such ... is one such biomedical project, whose aim is ...
... center responsible for responding goes into gear, setting off a ... from the adrenal glands. Dr. Gil Levkowitz ... now revealed a new kind of ON-OFF switch in the ... from the brain that stimulates cortisol release in the body. ...
... by a University of California, Davis, plant scientist delivers a ... world-renowned wine industry. The study is set for publication ... the Proceedings of the National Academy of Sciences. "Many ... plant, but we believe that most microbes would have difficulty ...
Cached Biology News:European Integrated Structural Biology Infrastructure launching 2A unique on-off switch for hormone production 2Fused genes tackle deadly Pierce's disease in grapevines 2
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...
Rabbit polyclonal antibody to GluR2...
Biology Products: