Navigation Links
Acrylamide Polymerization A Practical Approach

Paul Menter, Bio-Rad Laboratories, 2000 Alfred Nobel Drive, Hercules, CA 94547 USA


Introduction
The unparalleled resolution and flexibility possible with polyacrylamide gel electrophoresis (PAGE) has led to its widespread use for the separation of proteins and nucleic acids. Gel porosity can be varied over a wide range to meet specific separation requirements. Electrophoresis gels and buffers can be chosen to provide separation on the basis of charge, size, or a combination of charge and size.

The key to mastering this powerful technique lies in the polymerization process itself. By understanding the important parameters, and following a few simple guidelines, the novice can become proficient and the experienced user can optimize separations even further.

This bulletin takes a practical approach to the preparation of polyacrylamide gels. Its purpose is to provide the information required to achieve reproducible, controllable polymerization. For those users interested only in the bare essentials, the Polymerization Protocols can be used as a laboratory guide.

Mechanism of Polymerization
Polyacrylamide gels are formed by copolymerization of acrylamide and bis-acrylamide (bis, N,N'-methylene-bisacrylamide). The reaction is a vinyl addition polymerization initiated by a free radical-generating system (Chrambach 1985). Polymerization is initiated by ammonium persulfate and TEMED (tetramethylethylenediamine): TEMED accelerates the rate of formation of free radicals from persulfate and these in turn catalyze polymerization. The persulfate free radicals convert acrylamide monomers to free radicals which react with unactivated monomers
'"/>

Source:


Page: All 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20

Related biology technology :

1. Quantitation of Acrylamide in Food Samples on the Finnigan TSQ Quantum Discovery by LC/APCI-MS/MS
2. Practical Applications of HyperDSC in a Pharmaceutical Laboratory
3. Practical Aspects of Evaluation of Chromatographic Data in Size Exclusion Chromatography
4. Separation and Comparison of Proteins From Virulent and Nonvirulent Strains of the Fish Pathogen Flavobacterium psychrophilum, Using a 2-D Electrophoretic Approach
5. Simple Approaches for Optimization of RT-PCR
Post Your Comments:
*Name:
*Comment:
*Email:
TAG: Acrylamide Polymerization Practical Approach

(Date:9/23/2014)... September 23, 2014 This is ... Global and China Isopropanol (IPA) industry. The report ... definitions, applications and industry chain structure. Global market ... with a focus on history, developments, trends and ... the international and Chinese situation is also offered. ...
(Date:9/23/2014)... York , September 23, 2014 ... leading provider of  Closed System Transfer     Devices ... exclusive partnership with Taiwanese distributor MedFront Medical Technology Corporation.  Equashield,s ... in Taiwan , ... as the company continues to expand globally, and ...
(Date:9/23/2014)... (PRWEB) September 23, 2014 Dr. Williams ... third book on healthcare offers a three phase process ... century healthcare delivery system that would go far beyond ... responsibility regarding the delivery of healthcare.” , “Every effort ... has failed to provide discernable progress throughout that system ...
(Date:9/23/2014)... 2014 New spin-out from ... Cambridge Innovation Capital and Johnson & Johnson Development ... company focused on harnessing the potential of circulating ... and treatment, today announced it has raised £4m ... and including Cambridge Innovation Capital and Johnson & ...
Breaking Biology Technology:(IPA) Isopropanol Industry International & China Development Trend Analysis Now Available at DeepResearchReports.com 2(IPA) Isopropanol Industry International & China Development Trend Analysis Now Available at DeepResearchReports.com 3Equashield Enters Taiwan Following Expansion to Australia, Japan, China 2Dr. Ira Williams Offers the Healthcare Solution Necessary for Patient Safety Improvement 2Inivata Raises £4m to Realise the Potential of ctDNA Analysis to Improve Cancer Treatment Through Simple Blood Tests 2Inivata Raises £4m to Realise the Potential of ctDNA Analysis to Improve Cancer Treatment Through Simple Blood Tests 3Inivata Raises £4m to Realise the Potential of ctDNA Analysis to Improve Cancer Treatment Through Simple Blood Tests 4
... (NASDAQ: NEOG ) announces the following Webcast:What: ... 26, 2011 @ 11:00 ETWhere: , http://www.videonewswire.com/event.asp?id=80894 How: ... on to the web at the address above.  Contact: ... are unable to participate during the live webcast, the ...
... ,   Elsevier, a ... services, today announced the,highlights of its journal Impact Factor ... ® ,published by Thomson Reuters, Elsevier saw over 55% ... while slightly over 49%,of non-Elsevier journals showed an increased ...
... ,   Executives from O2h ... agreement to substantially,increase the number of FTE chemists provided by ... Congreve, Head of Chemistry at Heptares said, "O2h has,been a ... our synthetic chemistry team to include a full lab unit ...
Cached Biology Technology:Elsevier Announces 2010 Journal Impact Factor Highlights 2Elsevier Announces 2010 Journal Impact Factor Highlights 3Oxygen Healthcare (O2h) Announces Expanded Chemistry Collaboration With Heptares Therapeutics 2
(Date:9/23/2014)... the development of animals and plants. The central problem ... translated in a reliable manner to give specific spatial ... of stripe formation is a classic paradigm in developmental ... the French flag, is caused by a gradient of ... low concentrations of the morphogen a "blue", "white" or ...
(Date:9/23/2014)... SPRINGS, Florida , September 23, 2014 ... for innovative companies in tech sector position for significant investor ... products & services.  Companies in focus today are: NXT-ID, Inc. ... BABA ), Mobileye N.V. (NYSE: MBLY ... Robotics Ltd. (NASDAQ: RWLK) NXT-ID, Inc. (NASDAQ: ...
(Date:9/22/2014)... Many native species have vanished from tropical islands ... scientists have discovered how fossils can be used ... lies in organic materials found in fossil bones, ... according to a new study available online and ... of Herpetology . Pre-human island ecosystems provide vital ...
Breaking Biology News(10 mins):Recreating the stripe patterns found in animals by engineering synthetic gene networks 2Latest Blockbuster IPOs and Up Listings for Global Tech Stocks Attracting Major Attention as Traders Focus on Key Economic Data Due this Week 2Latest Blockbuster IPOs and Up Listings for Global Tech Stocks Attracting Major Attention as Traders Focus on Key Economic Data Due this Week 3Latest Blockbuster IPOs and Up Listings for Global Tech Stocks Attracting Major Attention as Traders Focus on Key Economic Data Due this Week 4Latest Blockbuster IPOs and Up Listings for Global Tech Stocks Attracting Major Attention as Traders Focus on Key Economic Data Due this Week 5Latest Blockbuster IPOs and Up Listings for Global Tech Stocks Attracting Major Attention as Traders Focus on Key Economic Data Due this Week 6Latest Blockbuster IPOs and Up Listings for Global Tech Stocks Attracting Major Attention as Traders Focus on Key Economic Data Due this Week 7Answer to restoring lost island biodiversity found in fossils 2
... , HERNDON, Va., Dec. 15 The PTR ... announced that it has agreed to sponsor three high school teams ... http://usfirst.org ). , The PTR Group will provide funding ... teams from Atholton HS in Columbia, MD, Rockwall HS in Rockwall, ...
... often promoted as a clean-burning, renewable fuel that could help ... caused by ozone, compared with gasoline, especially in winter, according ... Ozone production from both gasoline and E85, a blend of ... in warm sunny weather than during the cold weather and ...
... 10, 2009If you are spending the holidays with big Uncle ... be better off with another family, spare a thought for ... McMaster University and the University of New South Wales has ... members make strategic decisions about their living situation. ...
Cached Biology News:The PTR Group Announces Financial and Technical Support to US FIRST Robotics Competition Teams 2Ethanol-powered vehicles generate more ozone than gas-powered ones 2Ethanol-powered vehicles generate more ozone than gas-powered ones 3
Mouse monoclonal antibody raised against a partial recombinant DENR. NCBI Entrez Gene ID = DENR...
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
... monoclonal antibody raised against a partial recombinant NFKBIB. ... a.a. ~ 145 a.a) partial recombinant protein with ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
... Mouse polyclonal antibody raised against a partial ... FES (AAH35357, 120 a.a. ~ 250 a.a) ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products: