Navigation Links
A brief timeline of the stem cell debate

The first embryonic stem cells were isolated in mice in 1981. But it wasn't until 1998 that researchers managed to derive stem cells from human embryos. That kicked into full gear an ethical debate that continues to this day. Here's a look at key moments in the controversy so far:

November 1995: Researchers at the

Source:wistechnology.com By Joe Palca and Maria Godoy 05/10/06


Page: 1 2 3 4 5 6

Related biology technology :

1. Basking (briefly) in the DEMOfall 2006 glow
2. Misconceptions dominate the immigration debate
3. Candidates sparring over jobs focuses debate on right issue
4. Theres a new dynamic in the stem cell debate
5. Employees debate ethics of giving two weeks notice
6. Stem-cell debate, wireless access and other endeavors heat up
7. Separating science fiction from reality in the human cloning debate
8. Stem cell debate in Washington grows hotter as summer recess nears
9. Theres a surprising, and positive, side to the offshore jobs debate
Post Your Comments:
*Name:
*Comment:
*Email:
TAG: brief timeline the stem cell debate

(Date:12/22/2014)... , Dec. 22, 2014  Alternative Energy ... that it has signed a letter of intent ... has developed and patented a nanotechnology-based development platform ... products that enable rapid on-site collection and testing ... and health issues in an immediate, non-invasive and ...
(Date:12/22/2014)... 2014 The American Journal ... original research, reviews and editorials addressing developments and ... today published a provocative article exploring the role ... and potential treatment of prostate cancer. , ... proposes the possibility that there could be a ...
(Date:12/19/2014)... PA (PRWEB) December 19, 2014 ... leading developer and manufacturer of needle-free injection technology, ... agreement with Immunomic Therapeutics, Inc. (“ITI”) for ITI ... device with its LAMP™ vaccine platform. , ... an exclusive Worldwide license to the Biojector®-2000 that ...
(Date:12/19/2014)... 2014 Naurex Inc., a biopharmaceutical company leveraging ... of the central nervous system, today announced that ... will present at the 33 rd annual J.P. ... at 3:00 p.m. PST on Tuesday, January 13, 2015, ... Francisco, Calif. About Naurex ...
Breaking Biology Technology:ALNE Announces Intention To Acquire BioTechPharma 2Prostate Cancer Experts Dissect the Role of Follicle-stimulating Hormone in the Development, Progression and Potential Treatment of Prostate Cancer 2Prostate Cancer Experts Dissect the Role of Follicle-stimulating Hormone in the Development, Progression and Potential Treatment of Prostate Cancer 3Prostate Cancer Experts Dissect the Role of Follicle-stimulating Hormone in the Development, Progression and Potential Treatment of Prostate Cancer 4Bioject and Immunomic Therapeutics Enter into an Agreement for License of Needle-Free Technology for LAMP-vax Vaccines 2Bioject and Immunomic Therapeutics Enter into an Agreement for License of Needle-Free Technology for LAMP-vax Vaccines 3Naurex to Present at 33rd Annual J.P. Morgan Healthcare Conference 2
... Polytechnic Institute Professor James Jian-Qiang Lu was recognized ... toward the design and realization of 3-D integrated ... Department of Electrical, Computer, and Systems Engineering (ECSE) ... D. Ashman Achievement Award for 2010 from the ...
... Intarcia Therapeutics. Inc today announced that Kurt ... presenting at the Lazard Capital Markets 7th Annual ... Tuesday, November 16, 2010 at 1:40pm local time ... (Logo:   http://photos.prnewswire.com/prnh/20050301/SFTU126LOGO ) ...
... 11, 2010 StemCyte, Inc., one of the world,s ... is proud to announce that the Company has been ... Internal Revenue Service,s Qualifying Therapeutic Discovery Project (QTDP) program ... than 250 employees. The Patient Protection and ...
Cached Biology Technology:Rensselaer Polytechnic Institute professor James Lu garners award for research on 3-D computer chips 2Intarcia Therapeutics Executive Chairman, Kurt Graves to Present at Lazard Capital Markets 7th Annual Healthcare Conference 2StemCyte Awarded $488,950 for Advanced Therapeutic Applications of Umbilical Cord Blood Stem Cells from the Qualifying Therapeutic Discovery Project (QTDP) 2
(Date:12/11/2014)... Minn. , Dec. 10, 2014  Data ... physiologic monitoring, has released a new series of ... of preclinical toxicology researchers. M series, part of ... toxicologists collect the best possible physiologic data when ... Adding functional endpoints to toxicology studies has ...
(Date:12/10/2014)... , Dec. 08, 2014 Research and Markets ... addition of the "Biometrics Market in Japan ... http://photos.prnewswire.com/prnh/20130307/600769 The ... such as rural banking and upgradation of the ... witnessed in the market. Besides the aforementioned projects, ...
(Date:12/3/2014)... , Dec. 2, 2014   Marvin ... deployed, innovative test solutions for military, aerospace, and ... version of its successful TS-900 PXI semiconductor ... and features of high-end systems to customers at ... value compared to traditional ATE. ...
Breaking Biology News(10 mins):New telemetry implants expected to change how large animal toxicology studies are conducted 2Biometrics Market in Japan 2014-2018: Key Vendors are DDS, Fujitsu, Hitachi and NEC 2Marvin Test Solutions Brings New Capabilities to PXI-Based Semiconductor Test with TS-960 2Marvin Test Solutions Brings New Capabilities to PXI-Based Semiconductor Test with TS-960 3
... 28, 2008) Just three years after it was discovered, ... to the Wildlife Conservation Society, which recently published the first-ever ... "kipunji," the large, forest-dwelling primate hovers at 1,117 individuals, according ... journal Oryx . The population estimate was ...
... at Houston say they are the first to provide ... may be an autoimmune disease. Their research could provide ... Findings appear online in Nature Medicine on ... Xia, M.D., Ph.D., an assistant professor of biochemistry and ...
... to dangerously low levels in diseases such as anemia ... cells, doctors filter platelets from donated blood, but this ... and cause other side effects in patients who need ... have been trying to generate platelets from embryonic stem ...
Cached Biology News:Pre-eclampsia may be autoimmune disease 2Pre-eclampsia may be autoimmune disease 3
Agarose II (Low Melt)...
... antibody raised against a partial recombinant FES. ... 120 a.a. ~ 250 a.a) partial recombinant ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Accession Number: AAH35357 ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
Biology Products: