Navigation Links
A Screen of shRNAs Targeting Tumor Suppressor Genes to Identify Factors Involved in Paclitaxel Sensitivity

> Features of the pLKO.1-Puro vector allow for transient or stable transfection of the shRNA as well as production of lentiviral particles. Unlike adenovirus or murine-based MMLV or MSCV retroviral systems, lentiviral-based particles permit efficient infection and integration of the specific shRNA construct into differentiated and non-dividing cells, overcoming low transfection and integration difficulties when using these cell lines. pLKO.1 allows for long-term knockdown and phenotypic observation and transduction of difficult or sensitive cell lines.



Figure 2. Screening Tumor Suppressor Knockdown Cells for Paclitaxel Sensitivity.
The MISSION TRC Human Tumor Suppressor Gene Family Set (Cat. No. SH0531) was used to screen for genes that could enhance cell sensitivity to the widely used cancer therapy drug, Paclitaxel. Lentiviral particles were used to transduce cells in 96-well plates and knock down the corresponding tumor suppressor gene expression. Cells were split into two samples. One sample set was treated with Paclitaxel and the second set received medium only. Results were normalized to pLKO.1-puro empty vector control virus (Cat. No. SHC001V). Outliers were observed that either conferred more resistance or sensitivity to Paclitaxel treatment. The red data point represents a positive control for increased sensitivity to Paclitaxel.


Figure 3. Multiple MISSIONTM shRNA Clones Per Target Produce the Same Phenotype.
Multiple clones for four genes conferred increased cell sensitivity to drug treatment. These genes have the potential to be prognostic markers in chemotherapeutic responses.


Similar article originally printed in Genetic Engineering News , Jan. 15,
'"/>

Source:


Page: All 1 2 3 4 5 6

Related biology technology :

1. Innovative Tissue Array Technology for High-Throughput Screening of Gene Expression
2. Screening of Beer-Spoilage Bacteria Using the LightCycler PCR Workflow System
3. LightCycler foodproof Beer Screening Kit
4. Perform RNAi Library Screens on Any Budget
5. Recommendations for Successful siRNA Library Screens
6. Setting up Successful siRNA Library Screens
7. Temporal Temperature Gradient Electrophoresis: A Powerful Technique to Screen Mutations
8. Development of a Multiplex Bead-Based Assay for Antibody Screening of a Nonhuman Primate Colony on the Bio-Plex System
9. Screening for potential beta 2-adrenergic receptor antagonists using CypHer5E and IN Cell Analyzer 1000
10. Screening for β2-adrenergic receptor agonists using the pH-sensitive dye,CypHer5, and the IN Cell Analyzer 3000
11. A Mix-and-Read Cell-Based Assay for Hybridoma Screening Using the FMAT 8100 HTS System
Post Your Comments:
(Date:5/22/2015)... 2015 Charm Sciences, Inc. is ... Agriculture (USDA), Grain Inspection, Packers and Stockyards Administration ... Charm Sciences to monitor aflatoxin in grains utilizing ... ROSA FAST Aflatoxin Quantitative Test (solvent-based). , The ... uses Water Extraction Technology to extract aflatoxin from ...
(Date:5/21/2015)... MO (PRWEB) May 21, 2015 Seventh ... the safety and efficacy of pharmaceutical products and medical ... Maryland Heights, MO 63043, a 50,000 sq. ft. building ... location, to enable strategic growth. Facility renovations will begin ... the new space will occur in September. , ...
(Date:5/21/2015)... May 21, 2015 uBiome, the ... a partnership with PicnicHealth, a healthcare company that ... diagnosed with Inflammatory Bowel Disease (IBD) will receive ... complementary uBiome research kit. Both companies were funded ... , For more information on this partnership ...
(Date:5/21/2015)... Bridgewater, NJ (PRWEB) May 21, 2015 ... and a method for diagnostic or therapeutic imaging within ... the apparatus uses an endoscope having a low cost, ... original USPTO filing date was October 18, 2013 and ... The technology enables the physician to customize the ...
Breaking Biology Technology:USDA-GIPSA (FGIS) Awards 5 Year Contract for Aflatoxin Tests to Charm Sciences 2Seventh Wave Laboratories Purchases Building for Expansion, Upcoming Move 2Seventh Wave Laboratories Purchases Building for Expansion, Upcoming Move 3uBiome Partners with PicnicHealth 2uBiome Partners with PicnicHealth 3IpAuctions™ Presents The Worlds Smallest Disposable Illuminated Endoscope For Auction 2IpAuctions™ Presents The Worlds Smallest Disposable Illuminated Endoscope For Auction 3
... Created Role of Senior Vice President of ... Philip R. Licari to Step Down as Chief Operating Officer upon Closing ... ... ), the manufacturer of the NxStage System One (TM),portable kidney dialysis machine, today ...
... SAN CARLOS, Calif., Aug. 29 Nektar,Therapeutics (Nasdaq: ... Lingnau has been,appointed to serve on its board ... with over 35 years of experience in,corporate management, ... to Nektar extensive pharmaceutical development and,commercialization experience at ...
... Colo., Aug. 29 Pharmion Corporation,(Nasdaq: PHRM ... Drug Administration,(FDA) has granted Fast Track designation for ... Fast Track programs are designed to facilitate ... that are intended to treat serious or,life-threatening conditions ...
Cached Biology Technology:NxStage Medical Provides Update on Medisystems Acquisition 2NxStage Medical Provides Update on Medisystems Acquisition 3NxStage Medical Provides Update on Medisystems Acquisition 4NxStage Medical Provides Update on Medisystems Acquisition 5Nektar Therapeutics Appoints Lutz Lingnau as New Board Member 2Nektar Therapeutics Appoints Lutz Lingnau as New Board Member 3Pharmion's Oral Azacitidine Granted Fast Track Status for Myelodysplastic Syndromes 2Pharmion's Oral Azacitidine Granted Fast Track Status for Myelodysplastic Syndromes 3Pharmion's Oral Azacitidine Granted Fast Track Status for Myelodysplastic Syndromes 4Pharmion's Oral Azacitidine Granted Fast Track Status for Myelodysplastic Syndromes 5Pharmion's Oral Azacitidine Granted Fast Track Status for Myelodysplastic Syndromes 6
(Date:5/7/2015)... Sweden , May 7, 2015 ... touch fingerprint sensors, FPC1022 and FPC1035, FPC,s smallest ... and FPC1035 are mainly considered for integration on ... size gives smartphone OEMs increased possibilities to integrate ... The decreased size also improves possibilities for module ...
(Date:5/5/2015)... NXT-ID, Inc. (NASDAQ: NXTD ) ("NXT-ID" or ... mobile commerce market, reminds investors and media that  Mr. ...  at CARTES SECURE CONNEXIONS AMERICA 2015, held in ... The three-day conference is organized into a series of nine ... Global Fraud: Where is the Trust in Cyberspace? ...
(Date:4/27/2015)... Apr. 27, 2015 NXT-ID, Inc. (NASDAQ: ... company focused on the growing mobile commerce market, announces ... pre-order customers the first week of May, 2015 and ... of May. Gino Pereira , ... for the company as Wocket® enters the consumer market. ...
Breaking Biology News(10 mins):FPC Introduces its Smallest Touch Fingerprint Sensors to Date 2NXT-ID, Inc.'s CTO, David Tunnell, Presents at CARTES SECURE CONNEXIONS AMERICA 2015 Today in Washington DC. 2NXT-ID, Inc.'s CTO, David Tunnell, Presents at CARTES SECURE CONNEXIONS AMERICA 2015 Today in Washington DC. 3Wocket, the Smartest Wallet You Will Ever Own, Announces Shipment to Pre-order Customers 2Wocket, the Smartest Wallet You Will Ever Own, Announces Shipment to Pre-order Customers 3
... change on the microbial communities of two important ecosystemsthe ... a University of Oklahoma research group has been awarded ... to Jizhong Zhou, OU professor of botany and microbiology ... results of these studies could potentially contribute to the ...
... Medical Research in Melbourne, Australia, has entered a ... to evaluate and potentially develop for research and ... The institute has a portfolio of more than ... facility for research into cancer, chronic inflammatory diseases ...
... scientists from Singapore led by the Genome Institute of ... Biology (IMCB), two biomedical research institutes of Singapore,s ... the most important genes in human embryonic stem cells ... cells work. Their research, published in top scientific journal ...
Cached Biology News:Biotech collaboration established to commercialize research reagents 2Singapore scientists first to perform genome-wide study of human stem cells 2
...
... is an evolutionarily conserved form of cell ... The central component of this process ... caspases. These enzymes participate in a ... response to pro-apoptotic signals and result in ...
... for high-yield protein expression ,The ... a high-yielding clone of Sf9 cells. Pre-adapted ... Cell Medium, these cells are recommended for ... baculovirus infection or transfection of appropriate vectors. ...
... Mouse monoclonal antibody raised against a partial ... (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant ... Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: ... AAH39825 OMIM: 154235, ...
Biology Products: