Navigation Links
Sinovac Begins the Production of Influenza A (H1N1) Vaccine
Date:6/8/2009

s SFDA has cleared the pandemic influenza vaccine for fast track approval, while the National Institute for the Control of Pharmaceutical and Biological Products (NICPBP) has committed a simultaneous lot release for H1N1 vaccine to ensure supply by early October 2009.

Yin added, ''Sinovac is pleased to lead the effort in providing vaccines against H1N1. Through our expertise and external collaborators, we are integrating the industry's resources to ensure that China's large population base has access to the H1N1 vaccine, consistent with our ultimate mission to supply vaccines to the public that offer the maximum possible protection.''

At the end of May 2009, Sinovac completed all preparatory work for vaccine production against the H1N1 virus. On May 29, 2009 during a visit from China's Vice Premier, Li Keqiang, and his delegation, Li Keqiang emphasized the need for preventative vaccines and praised Sinovac for its efforts towards infectious disease prevention and social responsibility.

About Sinovac

Sinovac Biotech Ltd. is a China-based biopharmaceutical company that focuses on the research, development, manufacture and commercialization of vaccines that protect against human infectious diseases. Sinovac's vaccine products include Healive(R) (hepatitis A), Bilive(R) (combined hepatitis A and B), and Anflu(R) (influenza). Panflu(TM), Sinovac's pandemic influenza vaccine (H5N1), has already been approved for government stockpiling. Sinovac is developing vaccines for enterovirus 71, universal pandemic influenza, Japanese encephalitis vaccine, and human rabies vaccine. Its wholly owned subsidiary, Tangshan Yian, is conducting field trials for independently developed inactivated animal rabies vaccines.

Safe Harbor Statement

This announcement contains forward-looking statements. These statements are made under the "safe harbor" provisions of the U.S. Private Securi
'/>"/>

SOURCE Sinovac Biotech Ltd.
Copyright©2009 PR Newswire.
All rights reserved

Page: 1 2 3

Related biology technology :

1. Chinas Vice Premier, Li Keqiang, Visits Sinovac to Inspect H1N1 Vaccine Production Preparation
2. Sinovac to Host Conference Call to Report First Quarter 2009 Financial Results
3. Sinovac Biotech Ltd. Files Annual Report on Form 20-F
4. Sinovac Initiates Preparatory Activities for Swine Flu Vaccine
5. Sinovac Reports Unaudited Full Year 2008 and Fourth Quarter Financial Results with Financial Tables
6. Sinovac Reports Unaudited Full Year 2008 and Fourth Quarter Financial Results
7. Sinovac to Host Conference Call to Report Fourth Quarter and Full Year 2008 Financial Results
8. Sinovac Biotech Co. Ltd., Sinovacs Beijing Subsidiary, Obtains High-Tech Enterprise Status
9. Sinovac Receives GMP Certification for its New Filling and Packaging Production Facility
10. Sinovac Enters Veterinary Vaccine Market with Inactivated Rabies Vaccine
11. Sinovac Releases Statement on Healive Vaccine Suspension
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:6/19/2013)... Today DuPont Executive Vice President James C. Borel ... greatest challenge facing our time – ensuring food security ... at the International Food and Agribusiness Management Association ... students to contribute their time and talents to create ... collaboration with others. , “Food is one of the ...
(Date:6/19/2013)... India’s vast and growing population ... worth up to a billion dollars per year ... is taking serious action to better regulate and ... presentation will examine:, ,     Recent changes ... and long term impacts ,     Foreseeable opportunities ...
(Date:6/19/2013)... Adding to their already extensive supply ... Simport’s Dropette® and Heathrow Scientific disposable plastic ... basic biology, chemistry and any type of liquid handling ... 35 years, Simport has been supplying the science community ... the Simport Dropette®. Simport’s Dropette® is a one-piece ...
(Date:6/18/2013)... New York, NY (PRWEB) June 18, 2013 ... technological innovation and sustainability, the Consulate General of Switzerland ... largest solar boat, Switzerland’s MS Tûranor PlanetSolar , ... as part of its DeepWater Expedition 2013 tour with ... catamaran, led by Capitain Gérard d’Aboville, runs exclusively on ...
Breaking Biology Technology:DuPont Leader Calls for New Generation of Food Visionaries to Fight Hunger 2Leading Pipette Distributor Pipette.com Now Stocks Transfer Pipettes: Simport’s Dropette and Heathrow Scientific Disposable Plastic Transfer Pipettes 2Switzerland’s MS Tûranor PlanetSolar, the World’s Largest Solar Boat, Arrives in New York City 2Switzerland’s MS Tûranor PlanetSolar, the World’s Largest Solar Boat, Arrives in New York City 3Switzerland’s MS Tûranor PlanetSolar, the World’s Largest Solar Boat, Arrives in New York City 4
... MOUNTAIN VIEW, Calif., Jan. 17, 2012  MAP Pharmaceuticals, Inc. (Nasdaq: ... James O,Shea to its Board of Directors. Mr. O,Shea brings ... product commercialization and operations. "We are privileged to ... time in the Company,s development as we focus our efforts ...
... 16, 2012 Luminex Corporation (Nasdaq: LMNX ) ... fourth quarter and full year 2011 on Monday, February 6, ... release after the close of trading. (Logo: ... conference call to discuss the operating highlights and financial results ...
... 2012 Elsevier, a world-leading provider ... services, announced today that its first bilingual platform of ... , is now available online. NursingChina ... available in China, featuring skills within specialties such ...
Cached Biology Technology:MAP Pharmaceuticals Appoints W. James O'Shea to Board of Directors 2MAP Pharmaceuticals Appoints W. James O'Shea to Board of Directors 3Luminex Corporation Fourth Quarter and Full Year 2011 Earnings Release Scheduled for February 6, 2012 2Luminex Corporation Fourth Quarter and Full Year 2011 Earnings Release Scheduled for February 6, 2012 3Elsevier Launches Bilingual International Nursing Skill Training and Management Platform: NursingChina.com 2Elsevier Launches Bilingual International Nursing Skill Training and Management Platform: NursingChina.com 3
(Date:6/19/2013)... MOUNTAIN VIEW, Calif. , June 20, 2013 ... the personalized cosmeceuticals market, Frost & Sullivan recognizes ... Sullivan Award for New Product Innovation. geneOnyx leverages ... point-of-care testing to create an on-the-spot genetic test ... only a single-step DNA collection procedure from saliva ...
(Date:6/19/2013)... is playing a vital role in the survival of ... to climate and environmental changes, according to new research ... savannah birds from the Tanzanian Bird Atlas project - ... - the researchers found that they are using protected ... further west where dry seasons are getting longer, with ...
(Date:6/19/2013)... 19, 2013   Mercy Medical Center ... technology for conducting on-demand, Hemoglobin A 1c ... well as analysis of important red blood ... The new system enables the hospital to ... physicians and their patients, which can improve ...
Breaking Biology News(10 mins):Frost & Sullivan Applauds geneOnyx for its DNA Testing Solution for the Personalized Cosmeceuticals Market 2Frost & Sullivan Applauds geneOnyx for its DNA Testing Solution for the Personalized Cosmeceuticals Market 3Frost & Sullivan Applauds geneOnyx for its DNA Testing Solution for the Personalized Cosmeceuticals Market 4Protected areas provide African birds with stepping stones to survival 2Mercy Lab Offers Faster On-demand Diabetes Testing, Cellular Studies 2Mercy Lab Offers Faster On-demand Diabetes Testing, Cellular Studies 3Mercy Lab Offers Faster On-demand Diabetes Testing, Cellular Studies 4
... in biomedical science are on the horizon with ... Infrastructure (Instruct) in support of European biomedical research. ... (ESFRI) is involved in establishing about 40 such ... is one such biomedical project, whose aim is ...
... center responsible for responding goes into gear, setting off a ... from the adrenal glands. Dr. Gil Levkowitz ... now revealed a new kind of ON-OFF switch in the ... from the brain that stimulates cortisol release in the body. ...
... by a University of California, Davis, plant scientist delivers a ... world-renowned wine industry. The study is set for publication ... the Proceedings of the National Academy of Sciences. "Many ... plant, but we believe that most microbes would have difficulty ...
Cached Biology News:European Integrated Structural Biology Infrastructure launching 2A unique on-off switch for hormone production 2Fused genes tackle deadly Pierce's disease in grapevines 2
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...
Rabbit polyclonal antibody to GluR2...
Biology Products: